KEGG   Paraburkholderia xenovorans LB400: Bxe_A1755
Entry
Bxe_A1755         CDS       T00340                                 

Definition
(GenBank) Putative type IV secretion system protein VirB3/TraD
  KO
K03198  type IV secretion system protein VirB3
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bxe_A1755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bxe02044]
    Bxe_A1755
Secretion system [BR:bxe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Bxe_A1755
SSDB
Motif
Pfam: VirB3 PrgI
Other DBs
NCBI-ProteinID: ABE31202
UniProt: Q13XI7
Position
1:complement(2973183..2973503)
AA seq 106 aa
MKPLKDPVFKGATRPAMIWGVPLVAFLMVGGGMLIPAIWALLASPPLGVAILFLMIPVFV
VMRMITRHDDQRLAQYLLRVRMVLRQGNRRFWGGHAYVPVRLKRRA
NT seq 321 nt   +upstreamnt  +downstreamnt
atgaaaccgctcaaggatcccgtcttcaagggtgccacacgtccggcgatgatctggggc
gtgcccctcgtggccttcctgatggtcggtggcggcatgctgatcccggccatctgggcg
ctgctcgccagtccgccgctcggcgtcgcgatccttttcctgatgatcccggtgttcgtc
gtgatgcgcatgatcacgcgccacgacgaccagcgtctcgcgcagtacctgttgcgtgtg
cgcatggtgctgcgccagggcaaccgccgcttctggggcgggcatgcctatgtgccggtc
cgcctcaagaggagggcgtga

DBGET integrated database retrieval system