KEGG   Paraburkholderia xenovorans LB400: Bxe_A1844Help
Entry
Bxe_A1844         CDS       T00340                                 

Definition
(GenBank) Zinc-containing alcohol dehydrogenase superfamily
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00010  Glycolysis / Gluconeogenesis
bxe00071  Fatty acid degradation
bxe00350  Tyrosine metabolism
bxe00625  Chloroalkane and chloroalkene degradation
bxe00626  Naphthalene degradation
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_A1844
  Lipid metabolism
   00071 Fatty acid degradation
    Bxe_A1844
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bxe_A1844
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bxe_A1844
   00626 Naphthalene degradation
    Bxe_A1844
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bxe_A1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABE31119
UniProt: Q13XS0
Position
1:complement(2878185..2879171)
Genome map
AA seq 328 aa AA seqDB search
MRAMVFDGSSALLREQEVPDPKPGPGQLLIQIHACGVCRTDLHLVDHELEHPKQPVIPGH
EIVGTVAGLGAGVTGFAVGDRVGVPWLGHTCGHCRYCLSARENLCDEPGFTGYTIDGGYA
ERTVADSQYCFHLPAQYPDIEAAPLLCAGLIGYRTLKMAGDAQRIGIYGFGAAAHIVAQV
ALHQKRTVYAFTRPGDHAAQQLALRLGAAWAGGSDEAPPAELDAALIFAPVGALVPQALR
AVAKGGTVVCGGIHMSDIPSFPYAFLWGERRVVSIANLTREDGLAFMRIATERRLEIDTT
TYALTDANRALSDLRDGRLTGAAVLVVR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgatggtgttcgacggtagctcagcgttgttgcgtgagcaggaggtgccggac
ccgaagcccggtcccgggcaactgctgatccagattcacgcgtgcggcgtgtgccgcacc
gatcttcatctggttgaccatgagctcgagcatccgaagcagcccgtgattccgggccac
gagatcgtcggtaccgtggccgggctcggcgcgggtgtgacgggctttgccgtcggcgac
cgggtgggcgtgccgtggctcggccacacctgcgggcattgccgctactgcctgtcggcg
cgggaaaatctctgcgacgaaccgggcttcacgggctatacgatcgacggcggttacgcc
gagcgcaccgtcgccgacagtcagtattgctttcatctgccggcgcagtacccggatatc
gaggcggcgccgttgctgtgcgcgggtctgatcggctaccgcacgttgaaaatggcgggc
gacgcccagcggatcggcatttacggttttggcgcggcggcgcatatcgtcgcgcaggtc
gcgcttcatcagaagcgcacggtgtatgcgttcacgcgcccgggcgatcacgcggcccag
caactcgcgctgcgccttggcgcggcgtgggcgggcggcagcgacgaagcgccgcccgcc
gagctggatgcagccctgatcttcgcacccgtcggagcgctcgttccgcaagcattgcgc
gcggtggcaaaaggggggacggtggtgtgcggcgggattcacatgagcgacattccgtca
ttcccctacgcatttctgtggggcgagcggcgcgtggtatcgatcgccaatctgacgcgc
gaggacggacttgccttcatgcgaattgctaccgagcggcgcctcgagatcgacacgacc
acttacgcgctgacggatgcgaaccgggcactgagcgatctgcgggatggcaggttaacc
ggcgccgcggtgctcgtagtccggtag

DBGET integrated database retrieval system