KEGG   Paraburkholderia xenovorans LB400: Bxe_A2085
Entry
Bxe_A2085         CDS       T00340                                 

Definition
(GenBank) Putative membrane protein, SciS/IcmF-like protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bxe_A2085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bxe02044]
    Bxe_A2085
Secretion system [BR:bxe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bxe_A2085
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C
Other DBs
NCBI-ProteinID: ABE30883
UniProt: Q13YF6
Position
1:2623466..2627563
AA seq 1365 aa
MSFTHSARDPFFAGKLKLSFLVSRQFLALVALLVVALVIWFVGPLVAFGGMKPLATVGMR
VLVIALMLAGVLLWLAGWSPSVFFVALLCLLIWQASPLLAFGREQPFMPASARVIAIALV
LAIFVVYWAFRLWQKMRSDAQFLKSLLEFGGRKEASPAAEQLANVQAIVSGALARLKAMR
TGARGIGRLFQGKRYLYELPWYITLGSRGSGKTTALLNAGLSFPVAAQMQRTIGALAGTE
SVDWWLTNDAVLIDTAGHYTRHGTSQRERLSSTLAAAAAKSADKAKAASKNENASDKGKT
AVAFSAQAGAAAGSSPGNPDAARLHEKTDADEWFGFLALLRKHRPRAPINGAILTLELAT
LTGLDENARMAEAAALRGRLAELRETLGIRFPVYLVITKMDRLSGFNEYFASLPAEGRAQ
SWGFTLPYGKETIAAQGVRTRCEEELGLLATRLADGVNTRLQDEFDSTRRRQLVALSEEF
AALSQPLGELIERVFLDSRYDDTQLHATLRGVYFTSALQAGDTLVAERRTIAQRLAASFD
RVAGARASRPGGNQSYFLHDLLTRVVFAESQLVRPNLRWEFRFRLLRLIGHALAVLLFAW
LAIGLRFSFGHNSDYLSLISRKTQALSAKVAQLYKEPKAEAIPDTLTEARYLPAFPGLDL
ADPDSAYRFGLYTAPEIVTESSRTYDMLEDNLLLPQIVRRVEDVIAQAVANRDSKAAYDA
LRVYLMLYDKARFNADDVKAWVLNDWANTDSAAAFGGRASMIGHVQQLFSGSRVVQSPLI
RNDSLVQQARSFLDGSNATERLYERARTAMQKEAPDEFTLIRAVGPQAGLVFTRASGAPL
SRGVPGLFTFDGYRQLFDKRLPEFVAAARDDDAWVMGRSYLGEAQKKTAEFVSAATGADD
PLTDAIRRQYLTEYARQWDAFLGDIRTVSGTSLQFNLQVLRSFAAPDSPLARLARAAVRE
TTLTQPATAADGSLLQKTTDQLSQQADRTLGIRASEIVERELVDSHFAALREVVTGNADA
QTAQAATAQAGKTGLDGVTNLLNDYYTSLTVADNALANNSMPPASDTAAKLKMTANTMPP
PFRAVLLALAGDGSREVNQGIGQLLSRQMQAVVGDTCRLTIEGNYPFAADSRREVRIDDF
TRVFAHGGIIDDFFTKTLATFVDTSAKPWRYRTLPGATEPVQGPDLEPFQHARAIREIFF
ADADQKQLSWKADIRVPELDPTISALMIDIDGQTLLYQHGPVTPFPVTWPGTRGGVRAEL
TAEPRIRPETSTLAADGPWALMRLVQKGQIVETTIPGRTRVAFDFDGRKAVLDIAAVGSV
ANPLTSDVLKTFRCPSSMPTLTLTDSGPPPGLPQAAPPAAPDARD
NT seq 4098 nt   +upstreamnt  +downstreamnt
gtgagttttacacactcagcaagggatccattttttgcgggcaagctcaagttgtcgttt
ctggtatcgcgccagttcctcgcactcgtcgcgctgctcgtcgtcgcgctggtgatctgg
tttgtcggtcccctcgtggcgttcggcggcatgaagccgctcgccaccgtcggcatgcgc
gtgctggtgatcgcgctcatgctggccggcgtgctgctatggctggccggctggtccccc
agtgtgttcttcgtggcgctactgtgtctgctgatctggcaggcctcgccgcttctcgcg
ttcggccgtgaacagccgttcatgcccgcctcggcgcgcgttatcgcgattgcactcgta
ctggcgatattcgtcgtgtactgggcattccggctctggcaaaaaatgcgtagcgacgcg
cagttcctcaagagcctgctcgaattcggcggcaggaaagaggcctcgcccgcggcggag
caactggcgaacgtgcaggcgatcgtatccggcgcgctggcgcgcctgaaggcaatgcgc
accggagcgcgcggaatcgggcggctgtttcagggcaaacgctacctgtacgaactgccg
tggtacatcacgctcggttcgcggggctccggcaagacgaccgccttgctcaatgcggga
ttgtcgtttcccgtcgcggcgcagatgcagcgcaccatcggcgcgcttgccggcaccgag
tcagtcgactggtggctgaccaacgacgcagtgctgatcgataccgcgggtcactatacg
cggcacggcacctcgcagcgtgaacgcctgtcgtcgacgctcgctgccgcggccgcaaag
tctgctgacaaggcgaaggctgcgtcgaagaatgaaaacgcgagcgacaagggcaaaaca
gccgtggcgttctccgcgcaagccggcgcggcggcaggctccagcccgggcaatccggat
gcggcccggttgcacgagaaaaccgatgcggacgaatggttcggctttctggcgctgctg
cgcaagcaccggccgcgcgcgccgatcaacggcgcaatactgaccctggaacttgccacg
ctgacggggctggacgagaacgcgcgcatggccgaagccgccgcgttgcgcggccgtctc
gcggagctgcgcgaaacgctaggcatccgctttccggtttatctggtcatcaccaaaatg
gaccggctgagcggcttcaatgaatacttcgcttcattgccggccgaggggcgtgcccag
tcctggggctttaccctgccctacggcaaggaaaccattgcggcccagggcgtgcgcact
cgctgcgaagaggaactcggcctattggcaacccgtctggccgacggcgtcaacacgcgt
ttgcaggacgaattcgattcgacccgacgccggcagcttgtcgcgctatccgaagagttt
gccgcgctgtcgcagccgctcggcgagttgatcgaacgcgtgttcctcgactcgcgttac
gacgacacgcagcttcacgccaccctgcgcggcgtctatttcacgagcgcgcttcaagcc
ggcgacacgctggtcgccgagcggcggacaatcgcacagcggctggcggcgtcgttcgat
cgggtggcgggcgcgcgcgcgtccagaccgggcggcaatcagagctacttcctgcacgac
ctgctcaccagagtggtattcgccgagtcgcagctcgtgcggcccaacctgcgctgggaa
ttccgtttccgtctgctgcggctcatcggccatgcgctcgccgtgcttctgttcgcgtgg
ctcgcaatcgggctgcggttcagtttcggccacaacagcgactatctttcgctgatcagc
cgcaagacccaggcgctgagcgcaaaggtcgcgcaactgtacaaggagccgaaagccgaa
gcgatccccgatacgctcaccgaggcgcgctacctgccggcctttccggggctcgacctg
gcggacccggacagcgcgtatcgtttcggcctttatacggcacctgagattgtcaccgaa
agcagccgcacttacgacatgctcgaagacaatcttctgctgccgcagatcgtgcggcgt
gtcgaggacgtcatcgcgcaggcggtggcaaacagggattcgaaggcggcctacgacgcg
ctgcgtgtctacctgatgctgtacgacaaggccagattcaacgccgacgacgtgaaagcc
tgggtgctcaacgactgggcgaacacggacagcgcggcggctttcggcggccgggcctcg
atgatcgggcacgttcagcagctcttttcaggcagccgcgtggttcagtcaccgttgatc
cgcaacgattcgctggtgcagcaggcacgttcgttcctggatggcagcaacgccaccgag
cgtctgtatgaacgcgcgaggacggcaatgcaaaaggaagcgcccgacgaattcacgctg
atccgcgcggtcggaccgcaagccggactcgtcttcacgcgggcgagcggcgcgccgctg
tcgcgcggcgtgccgggactcttcaccttcgacggataccgccaactgttcgacaagcgc
ctgcccgagttcgtcgcggccgcgcgcgacgacgacgcctgggtgatgggccgctcctat
ctcggcgaggctcaaaaaaaaacggctgaattcgtcagcgccgcgaccggtgccgacgac
cctttgaccgacgcgatccgccggcaatacctgacggaatacgcgcgacagtgggacgcg
tttctgggcgacatccgcacggtcagcggcaccagtctgcagttcaacctccaggtgctg
cgcagtttcgcggcgccggattcaccgctggcacggctcgctcgcgcggcggtgcgcgag
accacgctgacgcaacccgccacggcggcagacggctccctcctgcagaagacgactgac
caactcagccagcaggcggacaggacgctcgggatccgggcttcggaaatcgtcgaacgc
gagctggtggatagtcacttcgccgcgctgcgcgaggtggtcacgggcaacgcggacgcc
cagaccgcccaggctgccactgcgcaggccggcaagaccggtctggacggcgtgacgaat
ctgctgaacgactactatacgtcgctgacggttgccgacaacgcgctcgccaacaacagc
atgccgccggcgagcgacaccgcggcgaagctcaagatgaccgccaacaccatgccgccg
ccgtttcgcgccgtgttgctggcgctcgccggcgacggctcgcgcgaggtgaatcagggc
atcggccaattgctgtcgcggcagatgcaggcggtggtcggcgacacctgccgtctcacg
atcgaaggcaactatccgttcgccgccgacagcaggcgcgaggtccgtatcgacgacttc
acgcgcgtgttcgcgcatggcggcatcatcgacgacttcttcacgaagacgctcgcgaca
ttcgtggatacctcggcgaaaccctggcgctacaggacgctgcccggcgccaccgagcct
gtccagggaccggacctcgaacccttccagcacgccagggcgattcgcgagatcttcttt
gccgatgcggaccagaaacagttgtcctggaaggccgatatccgggttccggagctcgat
ccgaccatcagcgccctgatgatcgatatcgacggccagacgctgctctatcagcatggg
ccggttacgccgttcccggtgacgtggccgggcacacgcggcggggtgcgcgcggagctg
acggccgaaccgcgcatccggccggagacttcgacgcttgcggcggacggtccgtgggcg
ctgatgcggctggttcagaaaggacagatcgtcgagaccacgatacccggccgcacgcgg
gttgcattcgacttcgacggccgcaaggccgtgctcgatatcgcggcggtgggcagcgtc
gccaatccgctgacgagcgatgtgctgaagaccttcagatgcccgagttcgatgccgacg
ctcaccctcaccgacagcgggccgccgccgggcctgccgcaggcggcgccacccgcggcc
ccggatgcgcgcgattga

DBGET integrated database retrieval system