KEGG   Paraburkholderia xenovorans LB400: Bxe_A2089
Entry
Bxe_A2089         CDS       T00340                                 

Definition
(GenBank) Hypothetical temperature-dependent protein secretion, ImpJ
  KO
K11893  type VI secretion system protein ImpJ
Organism
bxe  Paraburkholderia xenovorans LB400
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bxe02044]
    Bxe_A2089
Secretion system [BR:bxe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bxe_A2089
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: ABE30879
UniProt: Q13YG0
Position
1:2619387..2620733
AA seq 448 aa
MSWHNKVVWSEGLFLRPQLFQQQERYLEHYAHRRAATLSPFFFGFSHYSLDSEALALGKV
IVKSASGVFADGTPFDTPGSTPPPAPLTIRAEHLDQLIYLAVPVRVPNAEETTFDNAADS
LARNFVFDTELRDTNSIGQGPKTVQLSNLRLRLVPEKELTDAWIGLALTRVKTIRADSSI
VLDDTLIPPVAGFGASELLTSWLAKIHELTRLRANSLAIRLTGANGNAGTTAEVSDYLLL
QTLNRYEPLLQHLRRVPTTSPADLYALLLSMAGELSTYLRTDSRRPLDSHPAYQHSTPHL
CLKPLVDDTHVLLNAVLVRSAQSIELKELGHGMRNAVVDPVDMAGFTAVVLAVHAAMPPD
LLQQQFAAQAKAGPSERLPDLVRGHLPGITLQALPVPPRQIPFNAGFVYYELARSGPLWD
EVARHGGLALHVAGEFPSLKLELWGVRS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagctggcacaacaaagtcgtctggagcgaggggctttttctgcgcccgcagcttttc
cagcagcaggagcggtacctcgaacattacgcgcaccggcgcgcggccaccctgtcgccg
tttttcttcggcttcagtcattacagcctcgatagcgaggcactggcgctcggcaaggta
atcgtgaagtcggccagcggcgtgttcgcggacggcacgccgttcgatacgcccggcagc
acgccgccgcccgcgccgctcaccatccgcgcggaacatctcgatcaactgatctatctc
gccgtgcctgtgcgcgtgccgaacgccgaagagacgacgttcgacaacgccgccgactcg
cttgcccgcaacttcgtgttcgacaccgagctgcgcgatacgaattcgatcggacaaggc
ccgaagaccgtgcagttgtcgaatctgcggctgcgcctcgtgcccgagaaggaactgacc
gacgcatggatcggactcgcgctgacacgcgtgaagacgattcgcgcggacagcagcatc
gttctggacgatacattgattccgccggtggcgggcttcggcgcaagcgagctgctcacg
agctggctcgcgaagattcacgagctcacgcgcctgcgtgcaaactcgctcgcaatccgg
ctgaccggcgccaacggcaacgccggcaccacggcggaagtctccgactatctgctgttg
caaacgctcaaccgttacgagccgttgcttcagcatctgcggcgggtgccgaccacctcg
ccggcggatctgtacgcgctgctgctcagcatggcaggagaactgtcgacctacctgcgc
accgacagccggcgtccgctcgactcccatcccgcctatcagcacagcacgccgcatctc
tgcctgaagcctctggtggacgacacgcacgtgctgctcaatgcggtgctggtgcgtagc
gcgcagagcatcgaactgaaggaactgggacacggcatgcgcaacgccgtggtcgatccc
gtcgacatggccggcttcaccgcggtggtgctcgcggtgcacgccgcgatgccgcccgac
ctgctccagcaacagtttgccgcccaggcgaaagccggtccttctgaacggctgccggat
ctggtgcgcggacatctgccgggcatcacgctgcaggcgttgccggtgccgccgcgacag
atcccgttcaacgcgggcttcgtctattacgagctcgcgcgaagcggtccgttgtgggac
gaggtggcgcggcacggcggactcgccctgcacgtggccggcgagttcccgtcgctgaag
ctcgaactgtggggcgtgcgcagctaa

DBGET integrated database retrieval system