KEGG   Paraburkholderia xenovorans LB400: Bxe_A2925Help
Entry
Bxe_A2925         CDS       T00340                                 

Definition
(GenBank) amino acid ABC transporter ATP-binding protein, PAAT family
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bxe_A2925
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bxe02000]
    Bxe_A2925
Enzymes [BR:bxe01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     Bxe_A2925
Transporters [BR:bxe02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    Bxe_A2925
   Histidine transporter
    Bxe_A2925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_13 AAA_23 AAA_16 DUF87 PRK G-alpha AAA_33 FtsK_SpoIIIE APS_kinase RsgA_GTPase AAA_28 AAA_22 NACHT AAA_24
Motif
Other DBs
NCBI-ProteinID: ABE30051
UniProt: Q141D8
Position
1:1691794..1692621
Genome map
AA seq 275 aa AA seqDB search
MKIDPYFQRESILLHTTQTEACKLAVQDIHKRYGDNEVLKGVSLNANKGDVISIIGASGS
GKSTFLRCINFLERPNAGQIVVDGEAVKTKTDRAGNLEVADHKQLQRIRTKLAMVFQHFN
LWAHMNVIENIVEAPIHVLGLPRREAEERAREYLEKVGLAPRLEKQYPSHLSGGQQQRVA
IARALAMNPDVMLFDEPTSALDPELVGEVLKVMQKLAEEGRTMIVVTHEMGFARNVSNHV
MFLHQGRTEEEGLPAEVLSAPRSERLKQFLSGSLK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgatccgtattttcaaagggagagcatcttgctccacacgactcaaaccgaa
gcttgcaagctcgccgtacaggacatccacaagcgctacggcgacaacgaagtgctcaag
ggcgtgtcgctcaacgcgaacaagggcgacgtgatcagcatcatcggtgcgagcgggtcg
ggcaagagcaccttcctgcgctgcatcaattttctcgaacggcccaatgccgggcagatc
gtcgtggacggcgaagcggtgaagacgaaaaccgatcgcgccggcaatctcgaagtcgcg
gatcacaagcagttgcagcgcatccgcacgaagctcgcaatggtgttccagcacttcaac
ctgtgggcgcacatgaacgtgatcgagaacatcgtcgaagcgccgattcatgtgctcggc
ctgccgcgtcgcgaagcggaagagcgcgcgcgtgagtacctggagaaggttggcctcgcg
ccgcgcctcgaaaaacagtatccgtcgcatctgtcgggcggtcagcagcagcgcgtggcg
attgcccgcgcgctcgccatgaaccccgacgtgatgctgttcgacgagccgacttcggca
ctcgaccccgaactggtcggtgaagtgctgaaggtcatgcagaagctcgccgaagaaggc
cgcaccatgatcgtcgtcacgcacgaaatgggtttcgcgcgcaacgtgtcgaaccatgtg
atgttcctgcatcaaggccgcaccgaagaagagggcttgcccgcggaggtcctgagcgcg
ccgcgcagcgaacggctcaagcagttcctgtccggcagcctgaagtaa

DBGET integrated database retrieval system