KEGG   Paraburkholderia xenovorans LB400: Bxe_A2927Help
Entry
Bxe_A2927         CDS       T00340                                 

Definition
(GenBank) amino acid ABC transporter membrane protein 1, PAAT family
  KO
K10016  histidine transport system permease protein
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bxe_A2927
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bxe02000]
    Bxe_A2927
Transporters [BR:bxe02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    Bxe_A2927
   Histidine transporter
    Bxe_A2927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Stevor
Motif
Other DBs
NCBI-ProteinID: ABE30049
UniProt: Q141E0
Position
1:1690329..1691030
Genome map
AA seq 233 aa AA seqDB search
METRVFLYGFGPVLLAGTIQTIELSVLSLVAAVLLGLAGAAAKLSFSRPLRAIATGYTTL
IRSVPDLVLMLLLFYSIQIAVNDLTDALNLPQFDIDPFVAGVLTLGFIYGAYFTETFRGA
FLAVPRGQLEAGSAYGMSGARVFTRILFPQMMRFALPGIGNNWQVLVKATALVSIIGLAD
VVKAAQDAGKSTFNMFFFILIAALIYLAITTVSNLVLIWLEKRYSTGVRHAEL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggagacacgcgtgttcctatatggctttggtccggtgctgctggccggcacgatccag
acgatcgagctgtccgtcctgtcgctcgtggccgccgtgctgctcggcctcgcgggcgcg
gcggcgaaactctcgttcagtcgcccgctgcgcgcaatcgccaccggctacacgacgctg
atccgctcggtgcccgacctcgtgctaatgctgctgctgttctacagcatccagatcgcg
gtgaacgatctcaccgacgcgctgaatctgccgcagttcgatatcgatccgttcgtggcc
ggcgtgctgacgctcggcttcatttacggcgcgtacttcaccgagacgttccgcggcgcg
tttctggccgtgccgcgtggccagctcgaagcgggcagcgcgtacggcatgagcggcgcg
cgcgtgttcacgcgcatcctgtttccgcagatgatgcgcttcgcgctgccgggcatcggc
aacaactggcaggtgctggtgaaggccaccgcgctggtgtcgatcatcggtctcgccgac
gtggtcaaagccgcgcaggacgccggcaaaagcaccttcaacatgttcttcttcatcctg
atcgccgcgctgatctatctggctatcaccaccgtgtcgaatctcgtgctgatctggctg
gaaaagcgctattcgaccggcgtgcggcacgcggagctctga

DBGET integrated database retrieval system