KEGG   Paraburkholderia xenovorans LB400: Bxe_A2968Help
Entry
Bxe_A2968         CDS       T00340                                 

Definition
(GenBank) hypothetical protein
  KO
K01884  cysteinyl-tRNA synthetase, unknown class [EC:6.1.1.16]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bxe_A2968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bxe01007]
    Bxe_A2968
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bxe03016]
    Bxe_A2968
Enzymes [BR:bxe01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Bxe_A2968
Amino acid related enzymes [BR:bxe01007]
 Aminoacyl-tRNA synthetase
  Other
   Bxe_A2968
Transfer RNA biogenesis [BR:bxe03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Bxe_A2968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_114 GHL15 Glyco_hydro_66 GHL10
Motif
Other DBs
NCBI-ProteinID: ABE30011
UniProt: Q141H8
Position
1:1641815..1643002
Genome map
AA seq 395 aa AA seqDB search
MHQYDFGPLQRAARARLAFNVHCAGRLAHRWIGAAVVVAATGLMAACGGGSGGSGANSAN
ASSSSNSNNPASPATNANSNTSTNTNTNTNSNTSTNTNTQPTSPAPAIPATRALPASPVW
AAYYGQGSALDIAQAAAAFKLIVIDADPGNGSPAFSASQIAALKANGAKVLSYLNFGACE
KSRTYWNTVPSGFVSCGANTSAQIGKYQGFPEYWMNPANADYQNLIVNYVAARLAATGVD
GFMLDNFEIVGHGAGSSTAPCDAACAQGGLDLVRQLRDRFPDLVLVPNAAPVQAIGGTTG
GVSFPWLIDGVIAEQVFLPSTSTSIVQQLKSWRSAEQDLGRNGFFAGSLDYVSSCTASST
AQTAWTAAQQAGFSPSISTESLDSICWWSFLPRGS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagtatgactttggcccgcttcagcgggccgcccgcgcgcgccttgcgttcaat
gtccattgtgccggacggctcgcgcatcgatggatcggcgcggctgtcgtcgtcgccgct
accggcttgatggccgcttgcggaggcgggtcgggcggcagcggggctaattcggctaac
gcttcgagctcttccaactcgaacaatccggcgagtcccgcgacgaacgcaaacagcaac
accagcacgaacaccaacacgaacacgaacagcaacaccagcacgaacaccaacacccag
ccgacgagccccgcgccggcgatccccgcgactcgcgcgttgccggcctcgccggtgtgg
gcggcctattacggccagggcagcgcactcgacatcgcccaggccgcggccgcgttcaaa
ctgatcgtgatcgacgcggatcccggcaacggctcgcccgccttctccgcgtcgcagatc
gccgcgttgaaggcgaatggcgcgaaggtgctcagctacctgaatttcggcgcctgcgag
aagtcgcgcacatactggaacaccgtcccgtcgggtttcgtgtcgtgcggcgcgaacacg
tcggcgcaaatcggcaaatatcagggctttccggaatactggatgaatcccgccaacgcc
gactatcagaatctgatcgtcaactacgtggcggcgcggctcgcggcgaccggtgtcgac
ggcttcatgctggataacttcgagatcgtcggacacggcgccggttcgtccaccgctccg
tgcgacgcggcctgtgcgcaaggcggcctcgatctcgtcaggcagctgcgcgaccgtttt
ccggatctcgtgctggtgcccaatgccgcgccggttcaggctatcggcgggaccacggga
ggcgtatcgtttccgtggctgatcgacggcgtgatcgccgagcaggtcttcctgccgtcg
acgagcacgtcgatcgtgcagcagttgaagtcctggcggagcgcggagcaggacctcggg
cgcaacggcttcttcgcggggtcgctcgactacgtgtcgtcgtgcacggcgagctcgacc
gcgcaaaccgcgtggacggccgcgcaacaggcggggttcagtccgtcgatctcgactgag
tcgctcgacagtatctgctggtggtcgttcctgccgcggggcagttag

DBGET integrated database retrieval system