KEGG   Paraburkholderia xenovorans LB400: Bxe_A3896Help
Entry
Bxe_A3896         CDS       T00340                                 

Definition
(GenBank) Putative enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00071  Fatty acid degradation
bxe00280  Valine, leucine and isoleucine degradation
bxe00281  Geraniol degradation
bxe00310  Lysine degradation
bxe00360  Phenylalanine metabolism
bxe00362  Benzoate degradation
bxe00380  Tryptophan metabolism
bxe00410  beta-Alanine metabolism
bxe00627  Aminobenzoate degradation
bxe00640  Propanoate metabolism
bxe00650  Butanoate metabolism
bxe00903  Limonene and pinene degradation
bxe00930  Caprolactam degradation
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01212  Fatty acid metabolism
Module
bxe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bxe_A3896
   00650 Butanoate metabolism
    Bxe_A3896
  Lipid metabolism
   00071 Fatty acid degradation
    Bxe_A3896
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bxe_A3896
   00310 Lysine degradation
    Bxe_A3896
   00360 Phenylalanine metabolism
    Bxe_A3896
   00380 Tryptophan metabolism
    Bxe_A3896
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bxe_A3896
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bxe_A3896
   00281 Geraniol degradation
    Bxe_A3896
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bxe_A3896
   00627 Aminobenzoate degradation
    Bxe_A3896
   00930 Caprolactam degradation
    Bxe_A3896
Enzymes [BR:bxe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bxe_A3896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABE29101
UniProt: Q144Y8
Position
1:complement(631268..632092)
Genome map
AA seq 274 aa AA seqDB search
MVTTQNFNDHVRIEANEDIGVATIVLERPARRNAVDRPVAEALSAAFACFEAQPAWRAAV
LFGAGGTFCAGADLTALADDTRRNELHADGSGPGPMGPTRTSFSKPVVAAIAGYAVAGGL
ELAALCDLRVVEEDAVLGVFCRRVGIPLIDGGTIRLPRLIGLSRALDLILTGRAVSAQEA
LGFGLANRVVAKGTARAAAEQLAAELAALPQATLLADRRSVLENSMLDDFAEALRREGAG
GYRAVFEEGIAGAARFAEGTGRHGKTLDAGGGTR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccacgcaaaatttcaatgaccacgtgcgcatcgaagctaatgaggatatcggc
gtcgccacgatcgtccttgagcggcccgcgcgccgcaatgccgtcgatcgtcctgtcgcg
gaagcgctcagcgccgcgttcgcctgcttcgaagcccagccggcctggcgcgcggcggtg
ctgttcggcgcgggcggcactttctgcgccggcgcggacctgaccgctctcgccgacgac
acccgtcgcaacgaactgcacgccgacggcagcggtcccggcccgatgggaccgacgcgc
acgagcttcagcaagccggtggtcgccgcgattgccggctatgcggttgcgggcggtctg
gagctggcggcgctgtgcgatctgagagtggtcgaagaagacgccgtgctcggcgtgttc
tgccggcgcgtcgggattccgctgatcgacggcggcacgatccgcctgccgcgtctgatc
ggtctgtcacgcgcactggatctgattctgacgggccgcgcggtgagcgcgcaggaagcg
ctcggcttcggtctcgccaatcgcgtggtggccaaaggcacggctcgcgccgcagccgaa
cagttggccgccgagctggcggccttgccgcaggcgacgttgctcgccgaccgccgctcc
gtgctcgagaacagcatgctcgacgatttcgccgaagcgctgcgtcgtgaaggcgctggc
ggctatcgagccgtctttgaagaaggtatcgccggcgcggcgcgttttgccgaaggcaca
ggccgtcacggcaagacgctcgatgccggcggcggcacacgctag

DBGET integrated database retrieval system