KEGG   Paraburkholderia xenovorans LB400: Bxe_A3971Help
Entry
Bxe_A3971         CDS       T00340                                 

Definition
(GenBank) Putative carbon-nitrogen hydrolase protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bxe  Paraburkholderia xenovorans LB400
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bxe_A3971
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     Bxe_A3971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABE29028
UniProt: Q145G1
Position
1:complement(549493..550317)
Genome map
AA seq 274 aa AA seqDB search
MSSGSLESAFRVAALQMVSTPDRERNLAEAGRLIAEAAAEGAQLVLLPEYFCFMGFKDTD
KLAVREPYQDGPIQRFLADAARRHQIWVIGGTLPLMSPEASRVLNTTLVFDPQGNEAARY
DKIHLFNFEKGAESFDEARTICPGGEVRSFEAPFGRVGLSVCYDLRFPELYRRMGDCALI
VVPSAFTYTTGRAHWEMLLRARAVENQCYVLAAAQGGKHENGRRTWGHSMLIDPWGEIVA
LRDEGAGVVAGNLERARIDEVRQSLPAWRHRVLS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgtccagcggttccctggaaagcgccttccgtgtcgccgcgctgcaaatggtgagcaca
ccggatcgcgagcgcaatctcgccgaagccgggcgtctgatcgccgaggccgccgccgaa
ggcgcgcaactcgtcctgctgcctgagtacttctgcttcatgggcttcaaggacacggac
aagctcgccgtgcgcgaaccctatcaggacggaccgatccagcgctttctcgccgacgcc
gcgcgccgccaccagatctgggtgatcggcggcacgctgccgttgatgtcgcctgaagcc
tcgcgcgtgctgaacaccacgctggtgttcgacccgcagggcaacgaggccgcgcgctac
gacaagatccacctgttcaacttcgaaaagggcgcggaatcgttcgacgaagcgcgcacc
atctgccccggcggcgaagtgcgcagcttcgaggcgccgttcggccgcgtgggtctgtcg
gtctgctacgatctgcgctttccggagctgtaccggcgcatgggcgactgcgcgctgatc
gtggtgccgtcggcgttcacttacacgaccggccgcgcgcattgggaaatgctgctgcgc
gcgcgggcggtcgaaaaccagtgttacgtgctggccgcggcgcaaggcggcaaacatgaa
aatggccgccgtacgtggggccacagcatgctgatcgacccgtggggcgaaatcgtcgcg
ctgcgcgacgagggcgcaggcgtggtcgccggcaatctcgagcgtgcgcgcatcgacgaa
gtgcgacagagtctgcccgcctggcgtcatcgtgtgctcagttga

DBGET integrated database retrieval system