KEGG   Paraburkholderia xenovorans LB400: Bxe_A4132Help
Entry
Bxe_A4132         CDS       T00340                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00900  Terpenoid backbone biosynthesis
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bxe_A4132
Enzymes [BR:bxe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bxe_A4132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABE28868
UniProt: Q145X1
Position
1:complement(364346..365227)
Genome map
AA seq 293 aa AA seqDB search
MIETTDSLRDCLAPAKLNLFLHITGRRPDGYHTLQTVFQLLDWGDTLHFTRRDDGLITRR
TEIADVPPEHDLTVRAATLLKTHTGSPEGVDIEIDKRLPMGAGLGGGSSNAATTLLALNR
LWKLNLPRLELQALALKLGADVPFFVFGKNAFAQGVGEALDVVQLPPRHFLVVTPRVHVP
TAAIFSEKALTRDSKPLTITDFPAELSCNTEWPESFGRNDMQQVVVGKYAEVAQVLRWFE
NVAPARMSGSGASVFAAFRSKAEAEAVQAKLPAEWNSAVAASLDQHPLFTFAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaacgaccgattcgctgcgcgattgcctcgcgccagcgaaactcaacctcttc
ctgcacatcaccggccgccggccggatggctatcacacgctgcaaacggtgttccagttg
ctcgattggggcgacacgctgcacttcacgcgacgcgacgacgggctcatcacgcgccgc
accgaaatcgccgacgtgccgccggaacacgatctgaccgtgcgcgccgcgacgctgctc
aaaacgcatacgggctcgcccgaaggcgtcgatatcgaaatcgacaaacgcctgccgatg
ggcgccggcctcggcggcggcagctccaacgcagcgacgacactgctcgcgctcaaccgt
ctgtggaagctcaacctgccgcgcctcgaattgcaggcgctggcgttgaaactcggtgcg
gatgtaccgttttttgtgtttggaaaaaatgcgttcgctcagggtgtcggagaggcttta
gacgttgtacaattgccgccgcgccatttcctggtagtgacgccgagggttcatgttccg
actgcagcgattttctccgaaaaagcgttgacaagagattcaaaacccctcacaattacg
gactttcctgcagaacttagctgcaacactgaatggccagaaagttttggccggaacgac
atgcagcaggttgtcgtaggaaagtacgcggaagtagcgcaagtgctgcgatggtttgaa
aacgtcgcgccagcgcggatgtctggatcaggtgcaagtgtctttgcagcgttccgtagt
aaagctgaagcagaagcggtgcaagccaaactgccagccgaatggaacagcgcagtggcc
gcaagtctcgatcagcatccactctttactttcgcgtcataa

DBGET integrated database retrieval system