KEGG   Paraburkholderia xenovorans LB400: Bxe_B0216Help
Entry
Bxe_B0216         CDS       T00340                                 

Definition
(GenBank) putative polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00010  Glycolysis / Gluconeogenesis
bxe00520  Amino sugar and nucleotide sugar metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01200  Carbon metabolism
Module
bxe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_B0216
   00520 Amino sugar and nucleotide sugar metabolism
    Bxe_B0216
Enzymes [BR:bxe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Bxe_B0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hexokinase_1 Pan_kinase Tex_YqgF FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABE35727
UniProt: Q13JL2
Position
2:complement(3125630..3126430)
Genome map
AA seq 266 aa AA seqDB search
MATRKTKVTSSTERILAIDVGGTGLKAAIIDADGKMKTERVRVATPHPCTPDQLVDALAK
LVAPLVEQEPPTRMSIGFPGVVRNNRILTAPHFGVEGWHDIALADSLAQRLGGLPVRMIN
DAEMQGFAAISGQGLEFVLTLGTGAGTAMFRDGELMPHLELAHHPVSKKGVAYDEYIGDA
ARKKVGNKRWNRRVQKVIGILAALVNYDKLWIGGGNAARLTIDLPANVATVSNDAGIEGG
ARLWHAKSMRETRQLPEANERTGRFK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtggcaacacgtaagacgaaagtgacaagcagtaccgaacgaattctggcgatcgacgtt
ggcggcacgggtttgaaagccgcgatcatcgacgcggacggcaagatgaaaaccgaacgc
gtgcgggtggcgacgccgcatccttgtacgccggatcaactggtggacgcgctggcgaaa
ctggttgcgccgctcgtcgagcaggagccgcctacgcggatgtcgatcggctttccgggc
gtggtgcgcaacaaccgtattctgaccgcgccgcacttcggcgttgaaggctggcacgat
attgcactggctgattcgctggcgcagcggctgggcggtttgccggttcgcatgatcaac
gacgccgagatgcaaggtttcgccgcgatttcaggccagggcctcgaattcgtgctgaca
ctcggcacgggcgcgggtacggcgatgtttcgggacggtgagttgatgccgcatctggag
cttgcgcatcatccggtcagcaagaagggcgtggcgtacgacgaatatatcggcgatgct
gcgcgtaaaaaagtcggaaacaagcgctggaaccggcgcgttcagaaggtgatcgggatt
ctggcggcgctggtgaactacgacaaattgtggattggcggcggcaacgccgcgcgcctc
acgatcgatctcccggcaaacgtggcgaccgtttcgaacgatgccggcattgaaggcggg
gcgcgtctatggcatgcgaagtccatgcgtgagacgcgccaattgccggaagcaaatgag
cggacgggccgcttcaagtga

DBGET integrated database retrieval system