KEGG   Paraburkholderia xenovorans LB400: Bxe_B0315Help
Entry
Bxe_B0315         CDS       T00340                                 

Definition
(GenBank) putative acetoin dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00010  Glycolysis / Gluconeogenesis
bxe00020  Citrate cycle (TCA cycle)
bxe00620  Pyruvate metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01200  Carbon metabolism
Module
bxe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_B0315
   00020 Citrate cycle (TCA cycle)
    Bxe_B0315
   00620 Pyruvate metabolism
    Bxe_B0315
Enzymes [BR:bxe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bxe_B0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Biotin_lipoyl Hydrolase_4 Thioesterase Esterase Ser_hydrolase LIDHydrolase HlyD_3 PGAP1 Ndr
Motif
Other DBs
NCBI-ProteinID: ABE35631
UniProt: Q13JV8
Position
2:complement(3021044..3022156)
Genome map
AA seq 370 aa AA seqDB search
MPVHMITMPKWGLSMEQGQVNGWLKSIGDKVAKGEEILDVETDKISSGVECAFDGILRRQ
IAQEGDTLPIGALLAVVADPETADAEIDAAVEAFQRDFVPATADAGETGPQPEKVQIGGR
TVRYLKLGEGGTPAVLIHGFGGDLNNWLFNHADLAAHRTVWALDLPGHGESGKAVETGGA
EELADSVIAFMDDRGIGNAHLIGHSMGALVAMTVAERAPERVASLSLIAGAGLGDEINGE
YIGGFTEGSNRNALKPQLAKLFADPTLVTRQLVEDIVKYKRLEGVQDTLRKIAASAFDGD
VQRVVYRNRLAELVPRALVIWGAQDQIIPASHAQGLQGDIRVHVLEGKGHMVQMEAASEV
NRLLNDFLGR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccggttcatatgatcacgatgcccaagtggggcctttcgatggagcaggggcaggtc
aacggctggctcaagtcgatcggcgacaaggttgccaaaggcgaggaaatactcgacgtg
gagacggacaagatctcgtccggcgtcgagtgcgcattcgacggcatcttgcgccggcag
atcgcacaagagggcgacacgctgccgatcggcgcattgctcgctgtggtggccgacccg
gaaaccgcggacgcggagatcgacgcagcggtcgaagcgtttcagcgcgactttgtcccg
gccactgccgacgccggcgaaaccgggccgcaaccggaaaaggttcagatcggcgggcgc
accgtgcgctacctgaaactgggcgaaggcggcacgcccgcggtgctgattcacggcttt
ggcggcgacctcaacaactggctcttcaatcatgccgatctcgccgcgcatcgcacggtg
tgggcgctggatttgcccggccacggcgaatcgggcaaagcggtcgagaccggcggcgcg
gaagaattggccgacagcgtgatcgcgttcatggacgaccgcggtatcggtaacgcgcat
ctgatcggtcattcgatgggcgcgctggtcgccatgacggtggccgaaagggcgcccgag
cgtgttgcttcgctttcactgatcgcgggcgcggggctcggcgatgaaatcaacggcgag
tacatcggcggcttcacggagggtagcaatcgcaatgcgctcaagccgcaactggccaag
ctgtttgccgaccccacgctggtgacgcgccagctcgtggaggacatcgtcaagtacaag
cggctcgaaggcgtgcaggacaccttacgcaagatcgccgcgtccgctttcgacggcgac
gtgcagcgcgtggtctatcgcaaccggcttgcggaactcgttccgcgcgcgttggtgatc
tggggtgcgcaggatcagatcattcccgcttcgcacgcacagggattgcagggcgatatc
cgcgttcacgtgctcgaaggaaaagggcatatggtgcagatggaggcggcctcggaggtg
aaccgcctgctcaacgacttcctggggcgttga

DBGET integrated database retrieval system