KEGG   Paraburkholderia xenovorans LB400: Bxe_B1006Help
Entry
Bxe_B1006         CDS       T00340                                 

Definition
(GenBank) aldehyde dehydrogenase (acceptor)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00010  Glycolysis / Gluconeogenesis
bxe00053  Ascorbate and aldarate metabolism
bxe00071  Fatty acid degradation
bxe00280  Valine, leucine and isoleucine degradation
bxe00310  Lysine degradation
bxe00330  Arginine and proline metabolism
bxe00340  Histidine metabolism
bxe00380  Tryptophan metabolism
bxe00410  beta-Alanine metabolism
bxe00561  Glycerolipid metabolism
bxe00620  Pyruvate metabolism
bxe00625  Chloroalkane and chloroalkene degradation
bxe00903  Limonene and pinene degradation
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
Module
bxe_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_B1006
   00053 Ascorbate and aldarate metabolism
    Bxe_B1006
   00620 Pyruvate metabolism
    Bxe_B1006
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bxe_B1006
   00561 Glycerolipid metabolism
    Bxe_B1006
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bxe_B1006
   00310 Lysine degradation
    Bxe_B1006
   00330 Arginine and proline metabolism
    Bxe_B1006
   00340 Histidine metabolism
    Bxe_B1006
   00380 Tryptophan metabolism
    Bxe_B1006
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bxe_B1006
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bxe_B1006
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bxe_B1006
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Bxe_B1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 LuxC
Motif
Other DBs
NCBI-ProteinID: ABE34948
UniProt: Q13LU1
Position
2:complement(2248362..2249837)
Genome map
AA seq 491 aa AA seqDB search
MKRYQLFIDNEWVDPHSGAWFETDDPFTGEPWAEIPRADPTDADRAVRAAEKALEGPWST
LSASERGMLMYKLGALIERDAEHLATIESRDNGKLFRDVLGQMKYMAKYYYYFGGLADKI
QGAVVPIDKPGIFNFIRYEPMGVVLSITPWNSSLPLTTWKMAPALCAGNTIVCKPSEFTS
ASLFELAKLFVEAGFPRGVFNVVTGFGPEIGASLVSHPGVARIAFTGGDEAGRKIYAAAA
QHLKRVSLELGGKSPNIVFDDADLDQAVNGVISGIFSATGQTCVAGSRVLLQESIHDAFV
ERVAKLTRAAKVGNPLDPASEIGPITTKPQFEKILGYIDIATREGARCVAGGRALSGPGY
GAGRFVEPTVFVDVTNDMRIAQEEVFGPVLSIIRFKDEEDAIRIGNDIKFGLAAGVWTNS
LHRAMLMSQRLKAGTVWINNYRSSSFTTPFGGFKQSGIGREGGIESVKEFMEAKSVWMSS
DLKMPALFAGK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgctatcagttgttcatcgacaacgaatgggtggatccgcattcgggcgcctgg
ttcgaaaccgacgatccgttcacgggagagccgtgggcggagattccgcgggccgacccg
acggacgcggatcgcgcggttcgcgcggccgaaaaagcgctggagggaccgtggtcgaca
ctctcggcgagtgaacgcgggatgctgatgtacaagctcggcgcgctgatcgagcgtgat
gcggaacatctcgcgacgatcgaaagccgcgataacggcaagctctttcgcgatgtactc
ggccagatgaagtacatggcaaagtactactactatttcggcggtcttgccgacaagatt
caaggcgcggtcgtgccgatcgacaagccggggattttcaacttcattcgctatgaaccg
atgggtgtcgtactgagcatcacgccctggaactcatcgttgcccttgaccacgtggaag
atggcgccggctttatgtgccggcaatacgatagtgtgcaagccatccgaattcacgtcg
gcgtcgctattcgaacttgcgaaactgttcgtggaggccggatttccacgaggcgtattc
aatgtcgtgacgggcttcgggccggagatcggagcgtcgctcgtcagtcatccgggtgtc
gcgcggattgcgttcaccggtggcgatgaagcggggcgcaagatttacgcggcggcggca
cagcacctgaagcgcgtctctctcgaactgggcggcaagtcgccgaatatcgtgttcgac
gatgcggacctcgaccaggcggtcaacggtgtgatctccggcattttttcggcgaccggc
cagacctgcgtcgcgggttcccgtgtgcttttgcaggaatcgatacacgacgcgttcgtc
gaacgggttgcaaagctgaccagggcggcgaaggtcggcaatccgctggatccggcgagc
gagatcggaccgatcaccaccaagccgcagttcgagaagattctcggctacatagacatc
gcgaccagggaaggcgcgcgctgcgtggccggcggccgcgcgctttccggtcccgggtat
ggcgcgggccgattcgtcgagccgaccgttttcgtcgatgtgacgaacgacatgcgcatc
gcccaggaggaagtgttcggaccggtgctgtcgatcatcagattcaaggacgaagaagac
gcgatccggatcggtaacgacatcaaattcggactcgcagccggggtgtggacgaacagc
ctgcatcgcgcaatgttgatgtcgcaacgcctgaaggcgggcacggtatggatcaataac
taccgctccagcagtttcaccacgccttttggcggcttcaagcaaagcggcattggccgc
gaaggcggtatcgaatccgtcaaggaattcatggaggccaagagcgtctggatgtcgagc
gatctgaagatgccagcgctgttcgccggcaaatga

DBGET integrated database retrieval system