KEGG   Paraburkholderia xenovorans LB400: Bxe_B1758Help
Entry
Bxe_B1758         CDS       T00340                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00010  Glycolysis / Gluconeogenesis
bxe00052  Galactose metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_B1758
   00052 Galactose metabolism
    Bxe_B1758
Enzymes [BR:bxe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bxe_B1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABE34208
UniProt: Q13NY1
Position
2:1425966..1427084
Genome map
AA seq 372 aa AA seqDB search
MIERSTFGVLPDGERIERITLSLESGFSIDVISLGAALQALWAPDIEGQFASVVLGYPTL
EDYVSAPGRMGTTMGRYANRIARGCFDLDGVEYRIERNEGQHSIHGGPRGFDRRPWRVAN
VVDQAGSPKVRLELDSPCGDQGFPGALAIAVTYTLAAPGDVIIDFEAQTDAPTVFNTTNH
AYFNLAGEGSGSALHHEVAIFADHYLPVDEELIPIGQLHGVAGTVFDFRKAKPLGRDIRS
DDPQIRLGRGYDHCFVLSGAEHSLQPQLAAWVSEGSRGRTLEVLTTEPGLQLHSGNVLNG
RYSGLSGRAYRQSDGFCLEAQHFPNSPNVPAFPSTVLRPGDIFRSTTIYRVGLLGGYGKN
DGLWDPAKGGQI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacggtcgactttcggtgtgctacccgatggtgaacggattgagcgtataaca
ctgtcgctggagagcggcttctcgatagacgtgatctccctgggagcggcgttgcaggct
ctgtgggcacctgacatcgaaggccagtttgcgtcggtagtactcggctatccgacgctc
gaggattacgtttcagcaccgggccgtatggggacgacgatggggcggtatgcgaatcgt
atcgcgcgagggtgcttcgatctcgatggcgttgaataccggatcgaacgcaacgaaggt
cagcattccattcacggggggccacggggatttgatcgccggccttggcgcgtagcgaac
gtggtcgaccaggcgggtagcccgaaggttcgtctggaactggacagtccatgcggcgat
caaggatttccgggggcgttggccattgccgtgacgtatacgctcgccgcgccgggtgat
gtcatcatcgactttgaagcgcaaaccgacgctcccactgtattcaacacgaccaatcac
gcgtacttcaacctggcgggtgagggcagtggcagcgcgcttcaccatgaggtagcgata
ttcgccgatcattatttgccggtggacgaagaattgataccaatcggtcagttgcacggc
gtcgcgggcactgttttcgattttcggaaagcaaagccgcttgggcgtgatattcgatcc
gatgatccgcagattcgcctcggacgcggttacgaccactgcttcgtactatcgggcgct
gagcactcattgcaaccacagttggccgcctgggtgagcgagggctcgcgtggacgcacc
ctcgaggttctgactacggaacccggtttgcaactgcatagtggcaacgtactaaacgga
cgctatagcggattgtcgggacgggcttaccggcaatcagatggcttctgtctggaagct
cagcattttccgaattcaccgaatgtgccggcttttccaagcacggtgttgcggcccggt
gacatttttcgttcgacgacgatttatcgagtcggacttctgggtggctatgggaagaac
gacggactatgggatccagcgaagggaggtcaaatatga

DBGET integrated database retrieval system