KEGG   Paraburkholderia xenovorans LB400: Bxe_C0332Help
Entry
Bxe_C0332         CDS       T00340                                 

Definition
(GenBank) Thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00071  Fatty acid degradation
bxe00072  Synthesis and degradation of ketone bodies
bxe00280  Valine, leucine and isoleucine degradation
bxe00310  Lysine degradation
bxe00362  Benzoate degradation
bxe00380  Tryptophan metabolism
bxe00620  Pyruvate metabolism
bxe00630  Glyoxylate and dicarboxylate metabolism
bxe00640  Propanoate metabolism
bxe00650  Butanoate metabolism
bxe00900  Terpenoid backbone biosynthesis
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01200  Carbon metabolism
bxe01212  Fatty acid metabolism
bxe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bxe_C0332
   00630 Glyoxylate and dicarboxylate metabolism
    Bxe_C0332
   00640 Propanoate metabolism
    Bxe_C0332
   00650 Butanoate metabolism
    Bxe_C0332
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bxe_C0332
   00072 Synthesis and degradation of ketone bodies
    Bxe_C0332
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bxe_C0332
   00310 Lysine degradation
    Bxe_C0332
   00380 Tryptophan metabolism
    Bxe_C0332
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bxe_C0332
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bxe_C0332
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bxe_C0332
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bxe04147]
    Bxe_C0332
Enzymes [BR:bxe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bxe_C0332
Exosome [BR:bxe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bxe_C0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABE36247
UniProt: Q13I42
Position
3:complement(363310..364575)
Genome map
AA seq 421 aa AA seqDB search
MGRSPLTSFERPLVQTPTPEREFSVTGNTDIFVVAAARTAIGTFGGSLKDVPLAQLAILA
VRGTLERSGIAPSHVDHIVLGNVIPTEPRDAYLSRIAALEAGIPAQTPALNVNRLCGSGL
QAIILAAQSLLLGDAQVAIGAGAESMSRGPYLLPALRWGARTGDVQAADYMLGILHDPLH
RIHMGVTAENVAEREAITREMQDVLAVESQRRAAHAIAEGYFRSQIIPVEIPSRKGIVIF
DNDEHVRPETTFEQLSTMKPAFKHDGTVTAGNSSGINDGAAAVVLATGNAVKDHGLKPLA
RLVSYGHAGVDPRLMGLGPIPATHLALQRAGLTTGQLDVIESNEAFAAQACAVTQALDLD
PKKVNPNGSGISLGHPVGATGAIITTKAIFELHRTGGKYALVTMCIGGGQGIAAIFERTG
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggggcggtcgcccttgacttcatttgagcgaccgcttgttcaaacgccaaccccagag
cgagaattttcagtgactggtaatacagacatcttcgtcgttgctgcagcacgtaccgca
attggcacctttggcggctcactgaaggacgtgccgcttgcgcaactcgcgatccttgcc
gttcgcggcacgctcgagcgcagcggcatcgccccgtcacacgtggatcacatcgtgctc
ggcaacgtaattccgacggaaccgcgcgacgcctatctgtcgagaatcgccgccctggaa
gccggtattccagcgcaaacgcccgcgttaaatgtcaaccgcctgtgcgggtcggggttg
caggcgatcatcctggcagcacagtctctccttctcggcgacgcacaggttgcaattggt
gctggagccgaatcaatgagccggggcccctatctgctgccggccctgcgatggggagcc
agaacgggtgacgtgcaggccgcagactatatgcttggtatcctgcatgacccgttgcac
cgtattcacatgggcgttaccgccgagaacgtggccgagcgggaagccattacccgcgag
atgcaggacgtactggctgtggaaagccagcgtcgcgctgcgcacgcaatcgctgaaggt
tacttccggtcgcagatcatcccggtggaaataccttcgcgcaaaggcatcgtgatattc
gacaacgatgagcacgtgcgccctgagaccacattcgagcaactgtcgacgatgaagcca
gcctttaagcatgacgggacggtcactgctggcaattcctctggcatcaacgatggagcc
gccgcggttgttctcgccaccggtaacgcagtaaaggaccatgggttgaagccgctggcg
aggcttgtcagttatgggcacgcgggagtcgatccgcggttgatggggctcggccccata
cctgctacccatcttgccctgcagcgcgcaggacttacgaccggacaactggacgtcatc
gaatcaaacgaggcgtttgcagcccaagcctgcgcagtcacccaggcgctcgatctcgat
ccgaaaaaggtcaatcccaacggctccggaatctcgctgggccacccggtaggtgcaacc
ggcgcgatcatcaccaccaaggcaatcttcgagttacaccgtacgggcggcaaatatgcg
ctcgtcacgatgtgcatcggcggagggcaaggcattgctgcaatcttcgaacggacggga
ccatga

DBGET integrated database retrieval system