KEGG   Paraburkholderia xenovorans LB400: Bxe_C0452
Entry
Bxe_C0452         CDS       T00340                                 

Definition
(GenBank) Putative type IV secretion system protein VirB5/TraF
  KO
K03200  type IV secretion system protein VirB5
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bxe_C0452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bxe02044]
    Bxe_C0452
Secretion system [BR:bxe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Bxe_C0452
SSDB
Motif
Pfam: T4SS
Other DBs
NCBI-ProteinID: ABE36356
UniProt: Q13HT3
Position
3:472531..473238
AA seq 235 aa
MIASGVRRTLVAIAAATTSSLSSGVHAQGIPVYDAQNVIQAIATVGQLKQEVQQELQLYQ
SLSGTRGFGELMSNPVLSNSLPSNWQSVYTAIQHGGYAGLTGSAQTLRSASEIYNCEDQS
GIDQQVCQRALNKPFQDKAFGTQAYQTELDELDQIQGLMQQIDVTQDQKGIGELQARIQI
ESTAVGNEMTKLQLFRMLADSEDRLIAEQQQELVLKRAGNTARLQDQMVPAGFGN
NT seq 708 nt   +upstreamnt  +downstreamnt
atgatcgcttcaggtgtacgccgcactctcgtagccattgcggcagcaacgaccagcagc
ctgtcttccggcgtccatgcacagggcattccagtctacgacgcgcagaacgtcatacag
gcgatcgcgactgtcggtcaactgaaacaggaagtgcagcaggaacttcagctgtatcag
tcgctcagcggcacgcgcgggtttggcgagctgatgagcaatccggtcctgtcgaattca
ctgccgtcgaactggcagtcggtgtacacagcgatccagcacggcgggtatgcgggcctg
acgggcagcgcgcagacgctgcgctcggcgagcgaaatctacaactgcgaggaccagagc
ggcattgaccagcaggtctgccagcgcgcgctgaacaagccgtttcaggacaaggccttc
ggcacacaggcgtaccagacggaactcgatgaactcgaccagatccagggcctgatgcaa
cagatcgatgtgacgcaggaccagaaaggcatcggggaactgcaggcgcgcatccagatt
gagagcacggcggtcggcaatgaaatgacgaagctgcagcttttcaggatgctcgcagat
tcggaggaccggctgattgccgagcagcagcaggagcttgtgctcaagcgcgccggaaat
accgcacggctgcaggaccagatggtgcctgcgggctttggcaactga

DBGET integrated database retrieval system