KEGG   Paraburkholderia xenovorans LB400: Bxe_C1194
Entry
Bxe_C1194         CDS       T00340                                 

Gene name
bphA3
Definition
(GenBank) Biphenyl 2,3-dioxygenase ferredoxin subunit (BphA3)
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00621  Dioxin degradation
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
bxe01220  Degradation of aromatic compounds
Module
bxe_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:bxe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    Bxe_C1194 (bphA3)
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: ABE37056
UniProt: P37332
Structure
PDB: 
1FQT

Position
3:complement(1251450..1251779)
AA seq 109 aa
MKFTRVCDRRDVPEGEALKVESGGTSVAIFNVDGELFATQDRCTHGDWSLSDGGYLEGDV
VECSLHMGKFCVRTGKVKSPPPCEALKIFPIRIEDNDVLVDFEAGYLAP
NT seq 330 nt   +upstreamnt  +downstreamnt
atgaaatttaccagagtttgtgatcgaagagatgtgcccgaaggcgaagccctgaaggtc
gaaagtggaggcacctccgtcgcgattttcaatgtggatggcgagctgttcgcaacacag
gaccgctgcacccacggcgactggtccctgtccgatggcggctatcttgaaggtgacgtg
gtggaatgctcactgcacatggggaagttttgcgttcgcacgggcaaggtcaaatcaccg
ccgccctgtgaggcactgaagatatttccgatccgcatcgaagacaatgacgtgctggtc
gacttcgaagccgggtatctggcgccatga

DBGET integrated database retrieval system