KEGG   Bacillus amyloliquefaciens XH7: BAXH7_00336Help
Entry
BAXH7_00336       CDS       T01836                                 

Gene name
yclB
Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00130  Ubiquinone and other terpenoid-quinone biosynthesis
bxh00627  Aminobenzoate degradation
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01120  Microbial metabolism in diverse environments
bxh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bxh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BAXH7_00336 (yclB)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAXH7_00336 (yclB)
Enzymes [BR:bxh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     BAXH7_00336 (yclB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AEK87484
Position
348662..349240
Genome map
AA seq 192 aa AA seqDB search
MKLVIGMTGATGAIFGIRLLEYLKAAEIETHLVVSPWANVTITHETDYTLKDVEKLASYT
YSHKDQAAAISSGSFETDGMIIAPCSMKSLASIRTGMADNLLTRAADVILKERKKLVLLT
RETPLSQIHLENMLALTKMGSVILPPMPAFYNKPADMDELIDHIVFRTLDQFGIRLPEAK
RWYGIEKQKGGI
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgtcatcggaatgaccggggctacgggagccatattcgggatcaggctttta
gaatatttaaaggccgcggagatcgaaacccatcttgtcgtttctccttgggcaaatgtc
accatcacacatgaaaccgattatacgttaaaagatgtagagaaactggcgtcctatacg
tattctcacaaagaccaggcagcggcgatttcaagcggctcgtttgaaacggatgggatg
atcatcgctccgtgcagcatgaaatcacttgcaagcatccgcaccggaatggctgacaat
ctgctgacaagagcggctgacgtcatcctgaaagagcggaaaaaacttgtgcttctgacc
agagaaacgccgctcagccaaatccatttagagaatatgctagcgcttacaaaaatgggt
tccgtcattcttccgccgatgccggctttttacaacaaaccggctgacatggacgaattg
atcgaccacattgtgttccggacgctcgaccagttcggcatccgtctgccggaagcgaaa
cggtggtacggaattgaaaaacaaaaaggaggaatctga

DBGET integrated database retrieval system