KEGG   Bacillus amyloliquefaciens XH7: BAXH7_02526Help
Entry
BAXH7_02526       CDS       T01836                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00071  Fatty acid degradation
bxh00072  Synthesis and degradation of ketone bodies
bxh00280  Valine, leucine and isoleucine degradation
bxh00310  Lysine degradation
bxh00362  Benzoate degradation
bxh00380  Tryptophan metabolism
bxh00620  Pyruvate metabolism
bxh00630  Glyoxylate and dicarboxylate metabolism
bxh00640  Propanoate metabolism
bxh00650  Butanoate metabolism
bxh00900  Terpenoid backbone biosynthesis
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01120  Microbial metabolism in diverse environments
bxh01130  Biosynthesis of antibiotics
bxh01200  Carbon metabolism
bxh01212  Fatty acid metabolism
bxh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bxh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAXH7_02526 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BAXH7_02526 (mmgA)
   00640 Propanoate metabolism
    BAXH7_02526 (mmgA)
   00650 Butanoate metabolism
    BAXH7_02526 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BAXH7_02526 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BAXH7_02526 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAXH7_02526 (mmgA)
   00310 Lysine degradation
    BAXH7_02526 (mmgA)
   00380 Tryptophan metabolism
    BAXH7_02526 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAXH7_02526 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAXH7_02526 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BAXH7_02526 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bxh04147]
    BAXH7_02526 (mmgA)
Enzymes [BR:bxh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAXH7_02526 (mmgA)
Exosome [BR:bxh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAXH7_02526 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: AEK89654
Position
complement(2379939..2381120)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIAIKEAIKRAGISESEAEGAVMGMVVQAG
AGQIPARQAARHAGLPWSVPAETINKVCASGLRAVTICDQIIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSSAAKKYGISRDEQDHYAL
LSQKRAAEAAETGKLHEEIVPVTWTGKKGKQHTVAADEGLRPDTSLDQLAKLKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LKKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGIAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggctagaacgccgttcggaaaattcggcggggca
ttaaaagaggtaaaagcagccgagcttggcggcattgccataaaagaagcaatcaagcgc
gccggcatcagtgaaagtgaagcagaaggtgcggtgatgggaatggtcgtccaggcgggc
gcggggcagattccggcgcggcaggctgcgaggcatgccgggcttccatggtccgttccg
gctgaaaccattaataaggtctgtgcatcggggctcagagccgttaccatctgtgatcaa
atcatccgggcgaaagatgcggacgtgctgattgcaggcggtatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggagacggggtttttcag
gatttaatggttcatgacgggctgacctgtgcgtttgatcaggtgcatatggctgtccac
ggaagctctgcggccaaaaagtacggcatttcccgagatgaacaggatcattacgctctt
ttaagccagaaacgcgcggctgaggcagctgagacgggtaaattgcatgaagaaatcgtc
cccgtcacctggaccggcaaaaagggcaaacagcatactgttgcagcagatgaggggctg
cgtccggatacaagccttgaccagctcgcaaagctcaaacctatttttacagccgacgga
acggtcaccgccggaaacgctcccggtgtaaatgacggcgccggagcatttgtgctgatg
tcggaggaaaaagccgcgaagcagcatgtcagaccgctcgctgcgatacttggttttgcg
tctgtcggactggaagcgtccgagcttgcaagcgcgccgggagaagccatcagccggctc
ttgaaaaaaaccggtttgtccgttgacgacatcgatttgtttgaagtgaatgaagcattt
gcgtccgtcgtcctcgtgagcgaaaaaatagccgggttcagccgggagaaagtgaatgtt
aacgggggggcaattgcgttcggccatccgatcggcgcaagcggagccagaatcatcatg
agtttgatatacgaattaaagcggcgcggcggaggtttaggcatagcggcaatatgcagc
ggagcggctcaaggagacgccgtcctgctggaggtgtactga

DBGET integrated database retrieval system