KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03330Help
Entry
BAXH7_03330       CDS       T01836                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00260  Glycine, serine and threonine metabolism
bxh00750  Vitamin B6 metabolism
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01120  Microbial metabolism in diverse environments
bxh01230  Biosynthesis of amino acids
Module
bxh_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAXH7_03330 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BAXH7_03330 (thrC)
Enzymes [BR:bxh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BAXH7_03330 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEK90444
Position
complement(3097774..3098832)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEKLGVELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARAGMKCIVIIPDGKIAFGKLAQAVM
YGAEIIAIDGNFDDALAIVRSICEKAPIALVNSVNPYRIEGQKTAAFEVCEQLGGAPDIL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGSAAIVRGEVIKNPETVATAIRI
GNPASWDKAVLAAKESAGKIDEVTDEEILHAYQLIAREEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDVSELKPVTLPTNEDNILEYLNGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggactcattcatcaatataaagaatttctgccggtaacggatcagacgccg
gctctgacattgcatgaaggcaacacgccgctcattcaccttccgaagctttctgaaaag
ctcggagttgaattgcatgtgaagacagagggcgttaatccgacgggctcctttaaagat
cgcggcatggtcatggcggtcgccaaagcgaaagaagaaggcaatgacacgatcatgtgc
gcctcaacgggcaacacctctgcggcggctgcggcatacgcggcgagagccggcatgaaa
tgcatcgtcatcattccggacgggaaaatcgccttcggaaagcttgcgcaggccgtcatg
tacggagcggaaatcatcgcgattgacggaaactttgacgacgcgctggccatcgtcagg
tcgatttgtgaaaaagctccgattgcattagtgaattcagtaaacccttaccggattgaa
gggcaaaaaacagcggcctttgaagtatgcgaacagctcggcggagcgccggacattctg
gcgatcccggtaggaaacgcagggaatatcacggcctattggaaagggttcaaagaatat
catgagaaaaacggcaccggacttccgaagatgcgcggctttgaggcggaaggttctgca
gctatcgtccgcggcgaggtcattaaaaatcctgaaaccgttgcaacggcaatccggatc
ggaaacccggccagctgggacaaagccgttctcgcagcaaaagaatcagccggaaaaatt
gatgaggtcacagatgaagaaattcttcatgcctatcagctgattgcccgtgaagaaggc
gtatttgccgagccgggctcctgtgcatccatcgccggcgttttaaaacaggtcaaatcc
ggtgaaattccaaaaggaagcaaggttgtcgcagtcttgaccggcaacggcctgaaagat
ccgaacacggctgtagacgtatctgaattaaaaccggtcacgctgccgacgaatgaagac
aatattctggaatacttaaatggagcggcgcgtgtatga

DBGET integrated database retrieval system