KEGG   Bacillus amyloliquefaciens XH7: BAXH7_03529Help
Entry
BAXH7_03529       CDS       T01836                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bxh  Bacillus amyloliquefaciens XH7
Pathway
bxh00010  Glycolysis / Gluconeogenesis
bxh00051  Fructose and mannose metabolism
bxh00562  Inositol phosphate metabolism
bxh01100  Metabolic pathways
bxh01110  Biosynthesis of secondary metabolites
bxh01120  Microbial metabolism in diverse environments
bxh01130  Biosynthesis of antibiotics
bxh01200  Carbon metabolism
bxh01230  Biosynthesis of amino acids
Module
bxh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bxh_M00002  Glycolysis, core module involving three-carbon compounds
bxh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bxh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAXH7_03529 (tpiA)
   00051 Fructose and mannose metabolism
    BAXH7_03529 (tpiA)
   00562 Inositol phosphate metabolism
    BAXH7_03529 (tpiA)
Enzymes [BR:bxh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BAXH7_03529 (tpiA)
Exosome [BR:bxh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BAXH7_03529 (tpiA)
  Exosomal proteins of bladder cancer cells
   BAXH7_03529 (tpiA)
  Exosomal proteins of melanoma cells
   BAXH7_03529 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEK90641
Position
complement(3277295..3278056)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKNSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEENGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKVVAESFSQEAADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatagccggtaactggaaaatgaacaaaactctcggcgaggctgtc
agcttcgttgaagaagtgaaaaattccattccagcagcagacaaagcggaagccgttgtt
tgcgcaccagctcttttcttagaaaagctgacttctgctgttaaaggaactgacttaaaa
gtcggcgcccaaaacatgcattttgaagaaaacggtgcgttcacaggcgaaatcagcccg
gtcgctctgaaagaccttggcgtggattactgcgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcgcatgccgctttcaaacacggc
attgtgccgatcatttgcgtaggtgaaacgcttgaagagcgcgaagccggaaaaacaaat
gatcttgttgccgatcaagtgaaaaaaggtcttgcgggtctttctgaagagcaagttgca
gcttccgttattgcgtacgagccaatctgggcaatcggaacaggcaaatcttctacagcg
aaagatgcaaacgacgtctgcgcgcatatccgcaaagttgttgctgaaagcttcagccaa
gaagctgctgacaagctccgcattcaatacggcggcagcgtaaaacctgcaaatattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcaagccttgaaccg
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system