KEGG   Bacillus xiamenensis: BK049_10070Help
Entry
BK049_10070       CDS       T04852                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bxi  Bacillus xiamenensis
Pathway
bxi00071  Fatty acid degradation
bxi00072  Synthesis and degradation of ketone bodies
bxi00280  Valine, leucine and isoleucine degradation
bxi00310  Lysine degradation
bxi00362  Benzoate degradation
bxi00380  Tryptophan metabolism
bxi00620  Pyruvate metabolism
bxi00630  Glyoxylate and dicarboxylate metabolism
bxi00640  Propanoate metabolism
bxi00650  Butanoate metabolism
bxi00900  Terpenoid backbone biosynthesis
bxi01100  Metabolic pathways
bxi01110  Biosynthesis of secondary metabolites
bxi01120  Microbial metabolism in diverse environments
bxi01130  Biosynthesis of antibiotics
bxi01200  Carbon metabolism
bxi01212  Fatty acid metabolism
bxi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bxi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BK049_10070
   00630 Glyoxylate and dicarboxylate metabolism
    BK049_10070
   00640 Propanoate metabolism
    BK049_10070
   00650 Butanoate metabolism
    BK049_10070
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BK049_10070
   00072 Synthesis and degradation of ketone bodies
    BK049_10070
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BK049_10070
   00310 Lysine degradation
    BK049_10070
   00380 Tryptophan metabolism
    BK049_10070
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BK049_10070
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BK049_10070
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BK049_10070
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bxi04147]
    BK049_10070
Enzymes [BR:bxi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BK049_10070
Exosome [BR:bxi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BK049_10070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOZ88995
Position
1987420..1988595
Genome map
AA seq 391 aa AA seqDB search
MSKTVIVSGARTPFGKLGGLLSELTAAELGGITIKAALEGALGSHEVDEVIMGNVLQGGQ
GQIPSRQAARYADLPWSVPAQTINKVCASGMRSVSTADQMIRAGDANVIIAGGMESMSQA
PYLLKKARWGYKMGDGAVQDAMILDGLTCSFTGVHMGEYGSMAAKELGITREEQDLWALR
SHERAVEAQKSGFFQNEITPVTVKTKKGEQLITEDESPRRDTSYERLSKLLPVFDQTGTI
TAGNAPGVNDGASALLLMKDTYAMQQGEKPLAAVLGHAQVATEAKDFPKTPAFAIEKLLK
KTGKRVEDIDLFEINEAFSAVALACEKTLGLDRRKMNVNGGAVALGHPIGASGTRIILTL
IHALRQRGGGIGIAAICSGGGQGDAIMIKVD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagacggtcattgtttctggagcgagaacaccatttggaaaactgggcgggctt
ttaagtgaactgactgccgccgaattaggtggaatcacaatcaaggctgcgctggaaggt
gccttaggctctcatgaagtggatgaggtcatcatgggaaacgtacttcaaggaggacaa
ggtcaaatcccttcaaggcaagcagctagatatgctgatctcccatggtcggttccggcg
caaaccattaacaaagtctgtgcttcaggaatgcgtagcgtcagcacagctgatcagatg
attcgagcaggagatgccaacgtcatcatcgctggcggaatggaatctatgtctcaagct
ccctatcttctaaaaaaagcacgctggggctacaagatgggagatggcgcagtgcaagat
gcgatgattttagatgggcttacctgttcatttacaggagtccatatgggcgaatacggc
agtatggcggcaaaagagctcggtattacacgagaggagcaagatctctgggcgttaaga
agccatgaacgagcagttgaggctcaaaaaagcggcttttttcaaaatgaaatcactcca
gtcaccgtcaagacgaaaaaaggagaacagctgatcacagaagatgaatctccgcggcgt
gatacgtcatatgaacgattatcaaaactcctgcccgttttcgaccagactggtacaatc
actgccggaaacgcaccgggtgtcaatgacggagcaagtgcgctcctattaatgaaagac
acctatgccatgcagcaaggcgaaaaaccgctggcggcggtgcttgggcatgcgcaggta
gcaacagaggcaaaggactttccgaaaacaccagcctttgccatcgaaaagcttttaaag
aaaacaggcaaacgggtggaggatatcgatttgtttgaaatcaatgaggccttttcagcg
gtggcattggcatgcgaaaaaaccctcgggctggaccggcggaaaatgaatgtgaacgga
ggggccgtcgcccttggtcacccgattggggcaagcggaacacgtatcatactaaccttg
attcatgcactcagacaaagagggggcggcattggcattgctgcgatttgcagcggcggc
ggtcaaggagatgccatcatgatcaaggtggattaa

DBGET integrated database retrieval system