KEGG   Bacillus xiamenensis: BK049_14725Help
Entry
BK049_14725       CDS       T04852                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bxi  Bacillus xiamenensis
Pathway
bxi00860  Porphyrin and chlorophyll metabolism
bxi01100  Metabolic pathways
bxi01110  Biosynthesis of secondary metabolites
bxi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bxi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BK049_14725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bxi01007]
    BK049_14725
Enzymes [BR:bxi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BK049_14725
Amino acid related enzymes [BR:bxi01007]
 Aminotransferase (transaminase)
  Class III
   BK049_14725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AOZ89834
Position
2899323..2900615
Genome map
AA seq 430 aa AA seqDB search
MGRSYEKSKQAFEEAQHLMPGGVNSPVRAFKSVNTDPIFMERGKGAKIYDIDGNEYIDYV
LSWGPLILGHTNDRVVESIQRVAEHGTSFGASTLVENELAKLVSERVPSIEVIRMVSSGT
EATMSALRLARGFTGRNKIVKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVASNT
ITVPYNDLESIKVAFQEFGDDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIF
DEVMTGFRVDYHCAQGYFGITPDLTCLGKVIGGGLPVGAYGGRADIMRQIAPSGPIYQAG
TLSGNPLAMTAGLETLKQLTPESYEEFRRKGDRLEEGISKAAKANGIPLTFNRAGSMIGF
FFTNEKVVNYDTAKTADLALFAEFYKEMADHGIFLPPSQFEGLFLSTAHTDEDIDYTIET
VEKVFQKLRR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtagctatgaaaaatcgaagcaagcatttgaagaagcgcagcacttaatgcct
ggtggtgtgaacagccctgtgcgtgcatttaaatcagtcaacacagacccgatttttatg
gaacgaggaaaaggcgcaaagatatacgatattgacggaaatgaatacattgattatgtc
ttatcgtggggcccgcttattttaggacatacgaatgaccgtgtggttgaaagcatacag
cgagtagctgaacatggtacaagcttcggtgcttctactttagttgaaaatgaattagct
aagcttgtatcagaacgagttccttctattgaggtcattcgcatggtcagctctggaaca
gaggcgaccatgagtgcacttcgtctagcgcgcggctttacaggcagaaataaaattgtg
aaatttgagggctgctatcatggacatggtgattctttactcattaaagcgggatcaggt
gtagcaacgcttggtcttccagatagtcctggtgtccctgaaggtgttgcaagcaatacg
atcaccgttccatacaatgatttagaaagcatcaaagtcgctttccaggaatttggtgac
gacattgcaggtgtcattgtagaaccagttgcaggaaatatgggggttgttcctccgcaa
gaaggtttcttgcaaggcttaagagacatcacagagcaatacggctctttactcattttt
gatgaggtgatgacaggcttccgtgtggattatcactgcgcgcaaggctattttggcatt
acgcctgatctgacatgtcttggcaaagtgatcggaggcggtctgccagtcggcgcttat
ggaggaagagcggatattatgagacaaattgcaccaagcggaccgatctatcaagcagga
acgttatcgggtaacccgcttgccatgacagcaggtttagaaacattaaaacagctgaca
cctgagtcttatgaagaatttagacgaaaaggggatcggctggaagaaggcatttcaaaa
gcggcgaaagcaaatggaattccattaacgtttaaccgtgctggttccatgattggattc
ttctttacgaacgagaaggtcgtgaattacgacacagcgaaaacagcagacctcgcttta
ttcgctgaattttacaaggaaatggctgatcatggcatcttccttccaccttctcaattc
gaagggctgttcctatcaactgctcatacggatgaagacattgactatacgattgagaca
gtggaaaaggtatttcaaaaattacgtcgataa

DBGET integrated database retrieval system