KEGG   Bacillus xiamenensis: BK049_15210Help
Entry
BK049_15210       CDS       T04852                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bxi  Bacillus xiamenensis
Pathway
bxi00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bxi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BK049_15210
Enzymes [BR:bxi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BK049_15210
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BK049_15210
    1.1.1.-  
     BK049_15210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C Sacchrp_dh_NADP F420_oxidored ADH_N_assoc ApbA
Motif
Other DBs
NCBI-ProteinID: AOZ89920
UniProt: K2P2I2
Position
2992456..2993496
Genome map
AA seq 346 aa AA seqDB search
MKALRWHDQKDIRLEEIDEPTVAPGKVKLKVKWCGICGSDLHEYLGGPIFIPVNEPHPLT
KEKAPVTLGHEFSGEVVEVGEGVSDYKVGDRVVVEPIFATHGHQGAYNLDENLGFLGLAG
GGGGFSEYVSVDEELLHLLPDEISYEQGALVEPAAVALYAVRSSKLKAGDTAAVFGCGPI
GLLVIEALKAAGATDIYAVELSKERQEKAKELGAIIVDPSQYEDVVQEIARRTNGGVDVS
FEVTGVPVVLKQAIQSTRISGETVIVSIWEQGAEILPNDIVIKERTIKGIIGYRNIFPSV
LNLMRKGYFSADTLVTKKIKLDDVIEEGFHALINEKDQVKILVSAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactacgctggcacgatcaaaaggacattcgactagaggaaattgacgaacca
acagttgctccaggaaaagtgaagcttaaagtaaaatggtgcggcatttgtggtagtgat
ttacatgaatatttaggagggcctatcttcattccggtcaatgaacctcatccactgaca
aaagaaaaagcacctgtgacacttggtcatgagttttcaggtgaggttgttgaggtagga
gaaggtgtgagcgattacaaagtaggcgatcgagtcgttgtagaacctatttttgcaact
cacgggcatcaaggtgcctacaacttagatgaaaacttgggctttttaggacttgccggt
ggcggcggtggattctctgaatatgtatcagtcgatgaagaattacttcatttattacca
gacgaaatctcatatgaacaaggtgcactcgtagaacctgctgcagttgctttatatgcc
gttcgttctagtaaactaaaagctggggatacagcggctgtgtttggctgcggaccaatt
ggcttacttgtcattgaagcgctgaaagcggctggtgctacagatatttatgcagtggaa
ttatcaaaagagcgccaagaaaaagcaaaagagcttggagcgatcattgtagatccttct
caatatgaagatgttgttcaagaaatcgcccgccgtacaaacggtggagtcgatgtttct
tttgaagtgacaggtgtacctgttgtattgaagcaagccatccaatcaactagaatttca
ggtgaaacggtcattgtgagtatttgggagcaaggtgcagaaattctgccgaatgacatt
gtcattaaagaacggacaatcaaaggcatcattggctatagaaatatcttcccatctgta
ttaaacctaatgagaaaaggctatttctctgcggatacactcgtcacgaaaaaaatcaag
ctggacgatgtgatcgaggaaggcttccatgcattaatcaatgaaaaagatcaagtgaaa
attttagtcagtgctgaataa

DBGET integrated database retrieval system