KEGG   Bacteroides xylanisolvens: BXY_47020Help
Entry
BXY_47020         CDS       T02579                                 

Definition
(GenBank) pyruvate carboxylase subunit B
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
bxy  Bacteroides xylanisolvens
Pathway
bxy00020  Citrate cycle (TCA cycle)
bxy00620  Pyruvate metabolism
bxy01100  Metabolic pathways
bxy01120  Microbial metabolism in diverse environments
bxy01200  Carbon metabolism
bxy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bxy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BXY_47020
   00620 Pyruvate metabolism
    BXY_47020
Enzymes [BR:bxy01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BXY_47020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CBK69556
UniProt: D6D653
Position
complement(5733980..5735815)
Genome map
AA seq 611 aa AA seqDB search
MKREVKFSLVFRDMWQSAGKYVPRVDQLVKVAPAIIEMGCFARVETNGGGFEQVNLLFGE
NPNKAVREWTKPFHEAGIQTHMLDRALNGLRMSPVPADVRKLFYKVKKAQGTDITRTFCG
LNDVRNIAPSITYAKEAGMISQCSLCITHSPIHTVEYYTNMALELIKLGADEICIKDMAG
IGRPVSLGKIVANIKAAHPEIPVQYHSHAGPGFNMASILEVCEAGCDYIDVGMEPLSWGT
GHADLLSVQAMLKDAGYQVPEINMEAYMKVRGMIQEFMDDFLGLYISPKNRLMNSLLIAP
GLPGGMMGSLMADLESNLESINKYKAKHNLPFMTQDQLLIKLFDEVAYVWPRVGYPPLVT
PFSQYVKNLAMMNVMAMEKGKERWGMIADDIWDMILGKAGRLPGKLAPEIIEKAEREGRK
FFEGDPQNNYPDALDKYRKLMKENKWEVGQDDEELFEYAMHPAQYEAYKSGKAKEDFLED
VAKRRAEKDKSPEEDAKPKTLTVQVDGQAYRVTVAYGDTELPAAPAGAAAAPAGEGKEVL
SPLEGKFFLVKGAQETPLQVGDTVKEGDVICYVEAMKTYNAIRAEFGGTVTAICVNPGDA
VSEDDVLMKIG
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagaagtaaagtttagtttggttttccgagatatgtggcaatctgccggaaaa
tacgtacctcgtgtagaccaactcgtaaaggtagctcctgccatcattgaaatgggctgt
tttgcccgcgtagaaacaaacggcggaggttttgaacaggtaaatttattgtttggtgaa
aacccgaataaagcggtacgcgaatggacaaaaccgttccatgaagccggtattcaaacc
cacatgctcgaccgcgcactgaacggactccgtatgagccccgttccggcagacgtccgc
aaattattctacaaagtaaagaaagcacaaggaacagacattacccgtacgttctgcgga
ttgaacgacgtgcgtaacattgctccttccatcacatacgcaaaggaagcaggcatgatt
tcgcaatgctcgctttgcatcactcattcgcctatccataccgtagagtactacaccaat
atggcgctggaacttatcaaactgggagcagacgaaatctgtatcaaagacatggcaggt
atcggccgtcctgtatcgttaggtaagatcgtagcaaatatcaaggcggcacatcccgaa
atccccgttcagtatcacagtcatgcaggtcccggattcaatatggcaagcatcctcgaa
gtatgcgaagccggttgcgactatatcgacgtaggcatggaaccactatcatggggaaca
ggccatgctgacttgcttagtgtgcaggcgatgctgaaagacgccggatatcaagtgccc
gaaatcaatatggaagcctacatgaaagtgcgcggcatgattcaggaatttatggacgac
ttcctcggcttgtatatcagcccgaaaaaccgtctgatgaactccttgctgattgctccc
ggacttcccggcggtatgatgggtagtctgatggccgaccttgaatccaatctggaatca
atcaataaatataaggcaaaacacaatctgccgtttatgacgcaagaccagttgctcatc
aaactctttgatgaagtagcatacgtatggcctcgtgtcggttatcctccattggtgact
ccgttcagccaatacgtgaagaacctcgccatgatgaacgtgatggctatggaaaaagga
aaagaacgttggggaatgattgccgatgatatctgggatatgattctgggtaaagccgga
cgtctgccgggcaaacttgctcccgaaatcattgaaaaggcagaacgtgaaggccgtaag
ttcttcgaaggtgatccgcagaataactatcctgatgctctcgacaaatatcgcaaactg
atgaaagagaacaaatgggaagtgggacaggacgacgaagaactcttcgaatatgctatg
cacccggctcaatatgaggcttataagagcggtaaagcaaaagaggacttcctggaagac
gtagccaaacgtcgtgccgaaaaagataaatctccggaagaagatgccaaaccgaagaca
ctgaccgtacaagtggacggacaggcctatcgtgtgacggtagcatacggtgataccgaa
ctacctgctgctcctgcgggtgctgccgctgctccggcaggagagggtaaagaggtactt
tctccgttggaaggcaagttcttcttagtgaaaggtgcgcaggaaactcctttgcaagta
ggtgacactgtgaaagaaggtgatgtaatctgctatgtagaagcgatgaagacctacaat
gccatccgtgcagagtttggcggtacagtgactgctatctgtgtcaacccgggagatgct
gtttcagaagatgacgtattaatgaagataggataa

DBGET integrated database retrieval system