KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_0015Help
Entry
BANAU_0015        CDS       T02050                                 

Gene name
dck
Definition
(GenBank) deoxyadenosine/deoxycytidine kinase
  KO
K15519  deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00230  Purine metabolism
bya00240  Pyrimidine metabolism
bya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bya00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BANAU_0015 (dck)
   00240 Pyrimidine metabolism
    BANAU_0015 (dck)
Enzymes [BR:bya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     BANAU_0015 (dck)
    2.7.1.76  2'-deoxyadenosine kinase
     BANAU_0015 (dck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 SKI AAA_15 Cytidylate_kin2 TsaE AAA_22 ABC_tran RsgA_GTPase Cytidylate_kin RNA_helicase AAA AAA_16 MMR_HSR1 AAA_29 GTP_EFTU AAA_25 AAA_14 PRK AAA_5 ParA
Motif
Other DBs
NCBI-ProteinID: CCG48037
Position
complement(23708..24361)
Genome map
AA seq 217 aa AA seqDB search
MKDIHIPNNAIITVAGTVGVGKSTLTKALAKRLGFHTSLEEVDENPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNMFESGGGFVQDRSIYEDTGIFAKMHADKGTMSLTDYTTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENIINRIEKRGREMELQTNRSYWEEMYTRYEDWISGFNA
CPVLKVRIEDYDLEADEQSLEPLIEKISHVINENRNK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacattcatattccaaacaacgccattatcacagtagcgggaacggtaggagtc
ggaaaatcgactttgaccaaagctttagcaaaacggctcgggtttcatacctcactcgag
gaagtggatgaaaatccttatttagagaagttttatcacgattttgaacgctggagcttc
catttgcaaatttattttctggctgagaggttcaaagagcagaaaaatatgtttgaatca
ggcggcggattcgtgcaggaccgttcaatttatgaagatacaggcatattcgcaaaaatg
catgccgataaaggaaccatgtcgctgacagattacacaacatacacaagcctatttgag
gcgatggtcatgacgccgtacttcccgcatcctgatgttttgatctatttagaaggcgac
cttgaaaacattataaaccggattgaaaagcggggccgcgagatggagctgcagacaaac
cgctcctattgggaagagatgtatacgcggtacgaagactggatcagcggttttaacgcc
tgccctgtgctgaaagtacgcattgaagattatgaccttgaagctgatgaacagtcactg
gaacctttgatcgaaaaaatcagtcacgtgatcaacgaaaacagaaacaaataa

DBGET integrated database retrieval system