KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_2397Help
Entry
BANAU_2397        CDS       T02050                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00071  Fatty acid degradation
bya00072  Synthesis and degradation of ketone bodies
bya00280  Valine, leucine and isoleucine degradation
bya00310  Lysine degradation
bya00362  Benzoate degradation
bya00380  Tryptophan metabolism
bya00620  Pyruvate metabolism
bya00630  Glyoxylate and dicarboxylate metabolism
bya00640  Propanoate metabolism
bya00650  Butanoate metabolism
bya00900  Terpenoid backbone biosynthesis
bya01100  Metabolic pathways
bya01110  Biosynthesis of secondary metabolites
bya01120  Microbial metabolism in diverse environments
bya01130  Biosynthesis of antibiotics
bya01200  Carbon metabolism
bya01212  Fatty acid metabolism
bya02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BANAU_2397 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BANAU_2397 (mmgA)
   00640 Propanoate metabolism
    BANAU_2397 (mmgA)
   00650 Butanoate metabolism
    BANAU_2397 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BANAU_2397 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BANAU_2397 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BANAU_2397 (mmgA)
   00310 Lysine degradation
    BANAU_2397 (mmgA)
   00380 Tryptophan metabolism
    BANAU_2397 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BANAU_2397 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BANAU_2397 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BANAU_2397 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bya04147]
    BANAU_2397 (mmgA)
Enzymes [BR:bya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BANAU_2397 (mmgA)
Exosome [BR:bya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BANAU_2397 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2656
Motif
Other DBs
NCBI-ProteinID: CCG50418
Position
complement(2622753..2623934)
Genome map
AA seq 393 aa AA seqDB search
MGKTVIVSAARTPFGKFGGALKEVKAAELGGIVIKEAIKRAAISESEAEGAVMGMVVQAG
AGQIPARQAARYAGLPWSVPAETINKVCASGLRAVTICDQMIRAKDADVLIAGGMESMSN
IPYAIPAGRWGVRMGDGVFQDLMVHDGLTCAFDQVHMAVHGSTAAKKYGISRDEQDHYAL
LSQKRAAGAAEAGKLREEIVPVTWTGKKGKQHTVEADEGLRPDTSLEQLAALKPIFTADG
TVTAGNAPGVNDGAGAFVLMSEEKAAKQHVRPLAAILGFASVGLEASELASAPGEAISRL
LTKTGLSVDDIDLFEVNEAFASVVLVSEKIAGFSREKVNVNGGAIAFGHPIGASGARIIM
SLIYELKRRGGGLGIAAICSGAAQGDAVLLEVY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaaacggttatcgtcagtgcggcaagaacgccgttcggaaaattcggcggcgca
ttaaaagaagtaaaggcagccgagcttggcggcattgtcataaaagaagcaatcaagcgc
gccgctatcagtgaaagcgaagcggaaggagcggtgatgggaatggtcgtccaggcgggt
gccgggcagattccggcacgacaggctgcaagatatgccgggcttccatggtccgttccg
gctgaaaccattaataaggtctgtgcatcagggctcagggccgttaccatctgtgatcaa
atgatccgggcgaaagatgcggacgtgctgattgcaggcggaatggaaagcatgagcaac
attccgtacgccattccggccggccgctggggtgtgaggatgggggacggggtgtttcag
gatttaatggttcatgacgggctgacctgtgcgttcgaccaggtgcatatggctgtccac
ggaagcactgcggccaaaaagtacggcatttcccgggatgaacaggatcattacgctctt
ttgagccagaaacgtgcggcaggggcggctgaagcgggcaaattgcgtgaagaaatcgtt
cccgtcacctggaccggcaaaaagggcaaacagcatactgttgaagcggatgaggggctg
cgtcctgatacgagccttgagcagcttgcagcgctcaagccaatttttacagccgacgga
acggttacagccggaaacgctcccggtgtaaatgacggggccggagcatttgtgctgatg
tcagaggaaaaagccgcaaagcagcatgtcaggccgctcgcagcgatacttggctttgcg
tcagtcggactggaagcgtccgagctggcaagcgcgccgggagaggccatcagccggctc
ttgacaaaaaccggactgtccgttgacgatattgatttgtttgaagtaaatgaagcattt
gcgtccgtggtgctcgtgagtgaaaaaatagccgggttcagccgggagaaagtgaatgta
aacggaggggcaatcgcgttcggccacccgatcggcgcaagcggagcgagaatcatcatg
agtttaatatacgaattaaagcgtcgcggaggaggtttaggcatagcggctatatgcagc
ggagcggctcaaggagatgccgtcctgctggaggtgtactga

DBGET integrated database retrieval system