KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_3514Help
Entry
BANAU_3514        CDS       T02050                                 

Gene name
ywrD
Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya00430  Taurine and hypotaurine metabolism
bya00460  Cyanoamino acid metabolism
bya00480  Glutathione metabolism
bya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BANAU_3514 (ywrD)
   00460 Cyanoamino acid metabolism
    BANAU_3514 (ywrD)
   00480 Glutathione metabolism
    BANAU_3514 (ywrD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bya01002]
    BANAU_3514 (ywrD)
Enzymes [BR:bya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BANAU_3514 (ywrD)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BANAU_3514 (ywrD)
Peptidases and inhibitors [BR:bya01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BANAU_3514 (ywrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: CCG51535
Position
complement(3762974..3764551)
Genome map
AA seq 525 aa AA seqDB search
MNTSTIGTKQMVVSPHYLASQAGAGILEKGGNAFDAAVAVSACLAVVYPHMTGLGGDSFW
LTYHKETGRIKAYNGSGRSGKHVTRDLYRGREAIPLRGTESAITVPGMADSWDAVLSAYG
RLSLAEVLKPALDYAANGFPVSADQCAHTERNLALLASMPYTSAIFTRNKKAPMPGERFV
QKDLAASLEQLAEKGRSAFYEGDLAQRITSFLQNNGGRLTLDDFKAHRGEWTNPVSSDYR
GCKIYQAPPNSQGFTGLMTLNILENYDFSQIEHGSFDYYHLLIEALKKSFQHRNEVLTDP
AFSHIPLDRLLDKRYAKQLAEEIGNVAAPAVSRPIGSDTAYAAVADAEGNAVSFIQSLYF
EFGSAVTAGETGILLQNRGSFFSLDESHVNTLEPGKRTFHTLMPAMACKEGRPHILYGTQ
GGEGQPQTQTAMITRIIDYKMNPQQAINEPRWVWGRTWGEEYEGLRVESRISPETREALR
QSGHRVETVGDFDGLMGHAAAIVIDEEGFLQGGADPRGDGAAAGV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttcaaccatcggaacgaaacaaatggtcgtcagtccgcattatctcgcttct
caggcgggggccggcattctggaaaagggcggaaacgcgtttgacgcggcagtggcggtc
agcgcctgtctggcagtcgtgtatccgcatatgacgggtcttggcggggattcattttgg
ctcacttaccataaagaaacgggacgaatcaaagcttataacgggagcggccgttcaggg
aagcatgtgacgagagacttgtatcggggaagagaagcgatccctctgcgcgggacagaa
agcgccattaccgttccgggaatggcggacagctgggatgccgtgctttcggcgtacggg
cgtctttcgctcgctgaggtgctgaagcctgctcttgattatgcggcaaacggatttccg
gtgtccgccgaccagtgcgcccacacagaacgcaatctcgctcttttagcctcaatgcct
tacacctcggccatttttacgagaaacaaaaaagcgcccatgcccggtgaacggtttgtc
cagaaggatctggcggccagcttggagcagcttgccgagaaaggcagaagcgctttttat
gaaggagacctcgctcaacgcatcacatcctttctgcaaaacaacggcggccgtctgaca
cttgatgactttaaagcccaccgcggcgagtggacgaacccggtatcctccgattaccgc
gggtgcaaaatctatcaggctccgccgaattcacagggctttacaggcttaatgacgctc
aatatattggaaaactatgatttttctcagatcgaacacggttcctttgactattatcat
ctgctgatcgaggcgctgaagaagagttttcagcaccggaatgaagtgctgactgatccg
gcattttctcatattccgctggatcggctgcttgataaacggtatgcaaagcagcttgcg
gaagaaatcggtaacgtggctgcgccggcggtaagccggccgatcggaagcgacacagct
tatgccgccgtcgccgatgcggaaggaaatgccgtttcctttattcagagcctctatttc
gagttcggatctgccgttacagcgggggagacgggcattctgctgcaaaaccgcgggtca
tttttttcgctggacgaatctcatgtcaatacacttgaacccggcaagcggacgttccac
accctcatgccggcgatggcctgtaaagaaggaagaccgcacatcctgtacggaacccag
ggaggagaaggccagccgcaaactcagacagcgatgattacgcgcatcattgattacaaa
atgaacccccagcaggcgatcaatgagccgcgctgggtctggggacggacatggggagag
gagtatgaagggctgagggttgaaagcagaatcagccctgaaacgagagaagccctaagg
cagagcggccaccgcgtcgagaccgttggtgattttgacgggcttatgggccatgcggca
gcgatcgtcattgatgaagaaggctttctccaaggcggggccgacccgcgcggcgacgga
gcggccgcaggagtatag

DBGET integrated database retrieval system