KEGG   Bacillus velezensis YAU B9601-Y2: BANAU_3850Help
Entry
BANAU_3850        CDS       T02050                                 

Gene name
mrsR1
Definition
(GenBank) putative transcriptional regulator MrsR1
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bya  Bacillus velezensis YAU B9601-Y2
Pathway
bya02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bya00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BANAU_3850 (mrsR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bya02022]
    BANAU_3850 (mrsR1)
Two-component system [BR:bya02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BANAU_3850 (mrsR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: CCG51870
Position
4091347..4091988
Genome map
AA seq 213 aa AA seqDB search
MGKTLVCSENSYFQAYMNHLLTPDSNEIINVNTLDELKQIISKENFSSVIIDTCHPNDLV
LQLIKSISCPVIILNSLETNVSDYNPGPILNQINNVSTLKHNVFQLSFTTFFDVGKHCIW
KKNEYIPLAIQEFKILYLLYLNSNKIVCSEELIEYADLTGRSSLYVHISSLREKVEDNPG
DPKILQTKFGKGYLLSDSTYICLEKKADSKNVV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttggggaaaactctcgtttgttcagaaaatagctatttccaagcatatatgaatcattta
ttaacgccagatagtaatgaaataataaatgttaacacattggatgaactaaaacaaata
atatccaaagaaaatttttcctctgtaatcatcgatacttgccaccctaatgacttagtg
ttgcaactgataaaatcgatatcttgcccagtcataatacttaactccttagaaactaac
gtttcagattataaccctggtccaatattaaatcaaataaataatgtttcaaccctaaaa
cataatgtttttcaattgtctttcacaacttttttcgacgttggaaagcattgtatttgg
aaaaagaatgaatatatccctctagcaatacaagaatttaaaattttatatttgctttat
ttaaattcaaataaaatagtctgttctgaagaacttattgaatatgctgaccttactggt
aggtcaagtctttatgtacacattagttctcttagagaaaaagtagaggataaccctgga
gatccaaagattcttcaaacaaagtttggaaaagggtacctcttatctgacagtacatat
atttgtcttgaaaaaaaagcagactcaaaaaatgtcgtgtaa

DBGET integrated database retrieval system