KEGG   Burkholderia sp. YI23: BYI23_A002040Help
Entry
BYI23_A002040     CDS       T01711                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00010  Glycolysis / Gluconeogenesis
byi00260  Glycine, serine and threonine metabolism
byi00680  Methane metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
byi01200  Carbon metabolism
byi01230  Biosynthesis of amino acids
Module
byi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
byi_M00002  Glycolysis, core module involving three-carbon compounds
byi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_A002040
  Energy metabolism
   00680 Methane metabolism
    BYI23_A002040
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BYI23_A002040
Enzymes [BR:byi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BYI23_A002040
Membrane trafficking [BR:byi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BYI23_A002040
Exosome [BR:byi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BYI23_A002040
  Exosomal proteins of melanoma cells
   BYI23_A002040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AET88042
UniProt: G8MAS3
Position
1:complement(233400..234146)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGVLLKEAGYKFDIAYTSVLKR
AIRTLWHVQDEMDQMYIPVVHSWRLNERHYGALAGLNKAETAKKYGDDQVLVWRRSYDTP
PPALAPDDERASFGDPRYAKVPREQLPLTECLKDTVARVLPFWNESIAPAIKSGKQIVIS
AHGNSIRALVKYLDNISDQDIVGLNIPNGVPLVYELDENLKPIKHYYLGDPEAIAAAQAA
VAKQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctagtgctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgagcaaggcaaccgcgaggcgcgccaggccggc
gtgctgctcaaggaagccggctacaagttcgacatcgcctatacgtcggtgctgaagcgc
gcgatccgcacgctgtggcacgtgcaggacgagatggaccagatgtatatccccgtcgtg
cattcgtggcggctgaacgaacggcactacggcgcgctcgcgggtctgaacaaggccgaa
acggccaagaaatacggcgacgaccaggtgctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgcaccggacgacgagcgcgcatccttcggcgacccgcgctacgcgaag
gtgccgcgcgagcaactgccgctcaccgaatgcctgaaggacaccgtcgcgcgcgtgctg
ccgttctggaacgagtcgatcgcgccggccatcaagtcgggcaagcagatcgtgatttcg
gcacacggcaactcgatccgcgcgctcgtgaagtacctggacaacatttccgaccaggac
atcgtcgggctgaatatcccgaacggcgtgccgctcgtctatgagctcgacgagaacctg
aagcccatcaagcactactacctgggcgatccggaagccatcgcggccgcgcaggcggct
gtcgccaagcagggcaaggcgggctga

DBGET integrated database retrieval system