KEGG   Burkholderia sp. YI23: BYI23_A002810Help
Entry
BYI23_A002810     CDS       T01711                                 

Definition
(GenBank) Alpha/beta hydrolase fold-3 domain protein
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00903  Limonene and pinene degradation
byi00930  Caprolactam degradation
byi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BYI23_A002810
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BYI23_A002810
Enzymes [BR:byi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BYI23_A002810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 COesterase Peptidase_S9 Abhydrolase_2 UPF0227
Motif
Other DBs
NCBI-ProteinID: AET88119
UniProt: G8M3J3
Position
1:310951..311874
Genome map
AA seq 307 aa AA seqDB search
MSWQSALACWCVRIGMRPQSAKPELDVALARKYASRRLWSPRVPKGWRFEIRDNGEWLSP
ATRASATILYLHGGGYYFCSPRSHRAITFGLATRAHASVVSLDYRLAPEHRFPAALDDSV
AAYRRLLADGVPAQSIVIAGDSAGGGLALATLLALRDAADPLPAAAVLFSPWTDLTCAGE
SMRFNEGRDPMYHASVFPRVAAQYLGGADARDPYASPLFGDFTGLPPLMIHVGDTELLLD
DSTRVATKARAAGVRVDMQTWRDVPHIFQIWAPFMPEARESLTRAAAFIDAATCAARPHR
PLKTSIV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaaagcgccctggcttgctggtgcgtgcgcatcggtatgcgtccacaatcg
gcgaaaccggaactggatgtcgcactcgcgcgcaaatacgcgtcccgccggctctggtcg
ccgcgcgttcctaaaggctggcgcttcgagatacgcgataacggcgaatggctctcgccc
gcaacccgcgcgagcgcaaccatcctctatcttcatggcggcggctattatttctgctcg
ccgcgcagccaccgcgccatcaccttcggcctggccacgcgggcccatgcgagtgtcgtc
tcgctcgattaccgcctcgcgcccgagcatcgcttcccggctgcgctcgacgacagcgtc
gcggcctatcgccgcttgctcgccgacggcgttcccgcgcaatcgatcgtcatcgcaggc
gattcggccggtggcggcctcgcgctcgcgacgctgctcgcattgcgcgacgcggccgat
ccattgcccgcggcggcggtcctgttctcgccgtggacggacctgacctgcgccggtgag
tcgatgcgattcaacgagggccgcgatccgatgtatcacgcgtcggtgtttcctcgcgtg
gccgcgcagtatctcggtggcgccgacgcgcgcgacccgtacgcatcgccgctattcggc
gactttacgggcttgccgccgctcatgattcatgtcggcgacacggaattgctgctggac
gattcgacgcgcgtcgccacgaaagcccgcgcggccggcgtgcgcgtcgacatgcaaacg
tggcgcgacgtcccgcatatctttcagatctgggcgccgttcatgcccgaagcgcgcgaa
tcgctgacgcgcgccgccgcgttcatcgacgcggcgacatgcgccgcgcggcctcatcgt
ccgctcaagacttcgatcgtctga

DBGET integrated database retrieval system