KEGG   Burkholderia sp. YI23: BYI23_A006810Help
Entry
BYI23_A006810     CDS       T01711                                 

Definition
(GenBank) 2,3-dimethylmalate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00440  Phosphonate and phosphinate metabolism
byi01100  Metabolic pathways
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BYI23_A006810
Enzymes [BR:byi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BYI23_A006810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL NTP_transferase IspD TraD
Motif
Other DBs
NCBI-ProteinID: AET88519
UniProt: G8M5W2
Position
1:768788..770485
Genome map
AA seq 565 aa AA seqDB search
MNALTQIPVGYSRTMRLREMLQSNRLEFLMEAHNGISARIAKEAGFKAIWGSGLSISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADIDEFCGKIKAGKDSQSDPNFSIVARVEALIAGWGMEEALK
RAEAYRQAGADAILIHSKLSKPDEILTFAREWAGRGPLVIVPTKYYSTPTDAFRQAGISC
VIWANHLIRGAVSAMQAIAKEIHDSETLVNVEDRIAAVNEIFRLQDADEYSAAENIYLTA
ANEKRSAIVLAASRGAGLEALTEARPKVMLPVAGKPLLRHLVEAFKKESINDITVVGGYR
ADAIESGGIRLVVNERHETTGELASLACAAKHMNGDTVISYGDLLFRSYILRDLTESDSD
FCVVVDSSQAPQAGDTVTDFAYCSTGDDRALFGQKVWLESVVGAGQSLIENRAPQGRWMG
LIKVRGGARERLLATLGTLQQRADFDQLDMAALLNALIAAGQKIEVQYVHGHWRGVNDLD
DFRRAGDFAHGQTPIGSEGAENARD
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcactcacacaaatcccggtcggctactcgcgcacgatgcgcctgcgcgaaatg
ctgcaaagcaatcgcctcgaattcctgatggaagcgcacaacggcatctccgcgcgcatc
gcgaaggaagcgggcttcaaggcgatctggggctcgggcctgtcgatttccgcgcaattc
ggcgtgcgcgacaacaacgaggcaagctggacgcaagtcgtcgacaacctcgaattcatg
gcggacgcgagcgatctgccgattctcctcgacggcgacaccggctacggcaacttcaac
aacgtgcgccggctcgtgaagaagctggaacagcgcggcatcgcgggcgtgtgcatcgaa
gacaagcagtttccgaagaccaacagcttcatcaacggcgaggcgcagccgctcgcggac
atcgacgaattctgcggcaagatcaaggccggcaaggattcgcagagcgatccgaatttc
tcgatcgtcgcgcgcgtcgaggcgctgatcgcgggctggggcatggaagaagcgttgaag
cgcgccgaggcgtaccgtcaggcgggcgcggacgcgatcctgattcattcgaagctctcg
aagccggacgaaatcctcacgttcgcgcgtgaatgggccgggcgcggcccgctcgtcatc
gtgccgacgaagtactacagcacgccgaccgacgcgttccgtcaggcgggcatcagttgc
gtgatctgggcgaaccatctgattcgcggcgcggtctcggcgatgcaggcgatcgcgaag
gaaatccacgacagcgagacgctcgtcaacgtggaagaccgcatcgcggcggtcaacgag
attttccgtttgcaggacgcggacgaatactcggccgccgagaacatctatctgacggcg
gcgaatgaaaagcgcagcgcgatcgtgctggccgcgagccgcggcgcgggcctcgaagcg
ctgaccgaagcgcgtccgaaggtcatgctgccggtcgcgggcaagccgcttttgcgccat
ctcgtcgaggcgttcaagaaggaaagcatcaacgacatcacggtcgtcggcggatatcgc
gcggacgcgatcgagtcgggcggcatccgtctcgtcgtcaacgaacggcatgaaacgacg
ggcgagctcgcctcgctcgcctgcgccgcgaagcacatgaacggcgacaccgtgatttcc
tacggcgatctgctgttccgcagctacatcctgcgcgatctgacggaatcggacagcgat
ttctgcgtggtcgtggattcgtcgcaggcgccgcaggcgggcgacaccgtcaccgacttc
gcgtactgctcgaccggcgacgaccgcgcgctcttcggccagaaagtgtggctcgaaagc
gtggtcggcgcggggcagtcgctgatcgaaaatcgcgcgccgcagggccgctggatgggt
ctcatcaaggtgcgcggcggcgcgcgcgagcgtttgctcgcgacgctcggcacgctgcag
cagcgcgccgacttcgaccagctcgacatggccgcgctcctgaacgcgctgatcgccgcc
ggccagaagatcgaagtgcagtacgtgcacggccactggcgcggcgtgaacgatctcgac
gatttccgtcgcgcgggcgatttcgcgcacggccagacgccgatcggctccgaaggcgcg
gagaacgcgcgtgattga

DBGET integrated database retrieval system