KEGG   Burkholderia sp. YI23: BYI23_A009340Help
Entry
BYI23_A009340     CDS       T01711                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00010  Glycolysis / Gluconeogenesis
byi00620  Pyruvate metabolism
byi00640  Propanoate metabolism
byi00680  Methane metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
byi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BYI23_A009340
   00620 Pyruvate metabolism
    BYI23_A009340
   00640 Propanoate metabolism
    BYI23_A009340
  Energy metabolism
   00680 Methane metabolism
    BYI23_A009340
Enzymes [BR:byi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BYI23_A009340
Lipid biosynthesis proteins [BR:byi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BYI23_A009340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-ProteinID: AET88772
UniProt: G8M7I3
Position
1:1062117..1064171
Genome map
AA seq 684 aa AA seqDB search
MRRTRPIQRRAHRRILETPSKGLSMSAIESVLHEKRVFPPSAKASAGAAISGMDAYKALV
EHAERDYEGFWAGVARDTLAWHKPFTKVLDESKAPFYTWFEDGELNASYNCLDRHVEAGR
GADNAIIFEADDGTVTNVTYQDLLERVCRLANALKKRGVKKGDRVVIYLPMSVEGVVAMQ
ACVRIGATHSVVFGGFSSKSLNERLVDVGAVALITADEQMRGGKALPLKSIADEALAAGG
CEKVKDVIVYQRTGGKVQWTEGRDAWLHEIVENESAQCEPEWVSAEHPLFILYTSGSTGK
PKGVQHSTAGTLLWAAQTMKWTFDMKPGDIFWCTADIGWITGHSYIAYGPLAIGATQVMF
EGVPTYPNAGRFWEMIQRHKVTIFYTAPTAIRSLIKASEADAKVHPKSYDLSTLRILGTV
GEPINPEAWMWYHENVGRAQCPIVDTWWQTETGGHMITPLPGATPLVPGSCTLPLPGIMA
AVVDETGQDVPNGQGGILVVKRPWPSMLRNVWGDPKRYQTSYFPEELGGRLYLAGDGAVR
DKETGYFTIMGRIDDVLNVSGHRLGTMEIESALVANPMVAEAAVVGRPDDTTGEAVVAFV
VLKRSRPEGDEAKQIATELRNWVGKEIGPIAKPKDIRFGENLPKTRSGKIMRRLLRSLAK
GEEITQDVSTLENPAILDQLGEAR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcacgcggcccattcagcgacgcgcgcaccgccggattctggaaacaccatca
aaggggttgtcgatgtctgcgatcgaatcggttcttcatgaaaaacgcgtgttcccgccg
tcagccaaggcatcggcgggcgcggcaatctccggcatggacgcctacaaggcgcttgtc
gagcacgccgagcgcgactacgaaggcttctgggcgggagtcgcgcgcgacacgctcgcc
tggcacaagccgttcaccaaggtgctggacgagtcgaaggcgccgttctacacgtggttc
gaagacggcgagctcaacgcctcgtacaactgtctcgaccgtcatgtcgaagcgggccgc
ggcgccgacaacgcgatcatcttcgaagccgacgacggcaccgtcaccaacgtcacgtat
caggacttgctggagcgcgtctgccgcctcgccaatgcgctcaagaagcgcggcgtgaag
aagggcgaccgcgtcgtgatctatctgccgatgtcggtggaaggcgtcgtcgcgatgcag
gcgtgcgtgcgcatcggcgcaacgcattccgtcgtgttcggcggcttctcgtcgaaatcg
ctgaacgagcgtctggtcgatgtcggcgcggtcgcgctcatcaccgccgacgagcaaatg
cgcggcggcaaggcgctgccgctcaagagcatcgccgacgaagcgctcgccgcgggcggc
tgcgagaaggtgaaggacgtgatcgtctaccagcgcacgggcggcaaggtgcaatggacc
gaaggccgcgacgcgtggctgcacgagatcgtcgagaacgaatcggcgcagtgcgagccg
gaatgggtgagcgcggagcatccgcttttcatcctctacacgtccggctcgacgggcaag
cccaagggcgtgcagcacagcacggcgggcacgctgctgtgggccgcgcagaccatgaag
tggaccttcgacatgaagccgggcgacatcttctggtgtacggcggatatcggctggatc
acggggcatagctacatcgcgtacgggccgcttgcgatcggtgcgacgcaggtgatgttc
gaaggcgtgccgacgtatccgaacgcgggccgcttctgggagatgatccagcgtcacaag
gtcacgatcttctataccgcgcccaccgcgatccgctcgctcatcaaggcatcggaagcc
gatgcgaaagtgcatccgaagagctacgacctgtcgacgctgcgcatcctcggcacggtc
ggcgagccgatcaatccggaagcgtggatgtggtatcacgagaacgtcggccgcgcgcag
tgcccgatcgtcgatacgtggtggcagacggaaaccggcggccacatgatcacgccgctg
ccgggcgcgacgccgctcgtgccgggttcgtgcacgctgccgctgccgggcatcatggcc
gcggtcgtcgatgaaaccggtcaggacgtgccgaacgggcagggcggcattctggtcgtc
aagcgtccgtggccttccatgctgcgcaacgtgtggggcgatcccaagcgctatcagacg
agctatttccccgaagagctcggcggcaggctgtatctcgccggcgacggcgcggtgcgc
gataaggaaaccggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtctcc
ggccaccgcctcggcacgatggaaatcgagtcggcgctggtcgcgaatccgatggtggcg
gaagcggcggtcgtcggccgtccggacgacacgacgggtgaagccgtggtcgcgttcgtc
gtgctcaagcgttcgcgtccggaaggcgacgaagccaagcagatcgcgaccgaactgcgc
aactgggtcggcaaggaaatcggcccgatcgccaagccgaaggacatccgcttcggcgag
aatctgccgaagacgcgttcgggcaagatcatgcggcgacttttgcgctcgctcgcgaag
ggcgaggagatcacgcaggacgtctccacgctcgagaatcccgcgattctcgatcagctc
ggcgaagcgcgctga

DBGET integrated database retrieval system