KEGG   Burkholderia sp. YI23: BYI23_A012470Help
Entry
BYI23_A012470     CDS       T01711                                 

Definition
(GenBank) dTMP kinase
  KO
K00943  dTMP kinase [EC:2.7.4.9]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00240  Pyrimidine metabolism
byi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BYI23_A012470
Enzymes [BR:byi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.9  dTMP kinase
     BYI23_A012470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thymidylate_kin AAA_28 AAA_17 AAA_33 AAA_22
Motif
Other DBs
NCBI-ProteinID: AET89085
UniProt: G8M9E8
Position
1:1401679..1402302
Genome map
AA seq 207 aa AA seqDB search
MARGKFITFEGIDGAGKTTHLDWFRQQLAAKLEASGHQVVMTREPGGTPLGETLRGILLN
QPMDLETEALLMFAARREHLAQVIEPALSRGDWVLSDRFTDATFAYQGGGRGLPRDKLEA
LERWVQGGFQPDLTVLFDVPTDTASERRSAARAPDKFESESEAFFERTRGEYLRRAEESP
QRFFVVDSSRPIADIRKKLEEALADLC
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcggcaagttcatcacgttcgaaggcatcgacggcgcgggcaagaccacgcat
ctcgactggttccgccagcaactcgcggcaaagctcgaagccagcggacaccaggtcgtg
atgacgcgcgaaccgggcggcacgccgcttggcgaaacgctgcgcggcattctgctgaat
cagccgatggatctcgaaaccgaagcgctcctgatgttcgccgcgcgccgcgagcatctg
gcgcaggtgatcgaaccggcgctctcgcgcggcgactgggtcctgtcggaccgtttcacg
gacgcgactttcgcgtatcagggcggcgggcgcggcctgccgcgcgataagctggaggcg
ctggaaaggtgggtgcagggcggtttccagccggacctcaccgtactgttcgatgtgccg
accgacaccgccagcgagcgccgctcggccgcgcgcgcgccggacaagttcgaaagcgaa
tcggaagcgttcttcgagcgcacgcgcggcgagtatctgcgccgcgcggaggaatcgccg
cagcgctttttcgtcgtcgattcgagccggccgatcgccgatattcgcaagaagctcgaa
gaagcgctcgcagacctctgttaa

DBGET integrated database retrieval system