KEGG   Burkholderia sp. YI23: BYI23_A015830Help
Entry
BYI23_A015830     CDS       T01711                                 

Gene name
moaE
Definition
(GenBank) molybdopterin biosynthesis MoaE protein
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00790  Folate biosynthesis
byi01100  Metabolic pathways
byi04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BYI23_A015830 (moaE)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BYI23_A015830 (moaE)
Enzymes [BR:byi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     BYI23_A015830 (moaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoaE
Motif
Other DBs
NCBI-ProteinID: AET89421
UniProt: G8M461
Position
1:complement(1785526..1785999)
Genome map
AA seq 157 aa AA seqDB search
MSTHAKIRVQEADFDIGAEVAALRADNPKVGAVACFVGTVRDLNEGSAVETMELEHYPGM
TEKSLEAIADQARARWRGSDVLIVHRVGKLKPLDQIVLVATTAMHRAEAFESCAFVMDYL
KTQAPFWKKEKTEAGERWVDARESDDAALARWQNAKS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacatgccaagatccgcgtgcaggaagccgatttcgacatcggcgcggaagtc
gcggccctgcgcgccgacaatccgaaagtgggcgcggtcgcgtgcttcgtcggcacggtg
cgcgatctgaacgagggcagcgccgtcgagacgatggagctcgagcactatcccggcatg
acggaaaagtcgctggaagcgatcgccgatcaggcgcgcgcgcgctggcgcggctccgac
gtgctgatcgtgcatcgcgtgggaaagctgaagccgctcgatcagatcgtgctcgtcgcg
accacggcgatgcatcgcgcggaggcgttcgaatcctgcgccttcgtgatggattacctg
aagacgcaggcgccgttctggaagaaggaaaagacggaggccggcgagcgctgggtcgat
gcgcgcgaatccgacgatgcggcgctcgcgcgctggcagaacgcgaagtcctga

DBGET integrated database retrieval system