KEGG   Burkholderia sp. YI23: BYI23_A016130Help
Entry
BYI23_A016130     CDS       T01711                                 

Gene name
surE
Definition
(GenBank) stationary-phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00230  Purine metabolism
byi00240  Pyrimidine metabolism
byi00760  Nicotinate and nicotinamide metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BYI23_A016130 (surE)
   00240 Pyrimidine metabolism
    BYI23_A016130 (surE)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BYI23_A016130 (surE)
Enzymes [BR:byi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     BYI23_A016130 (surE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AET89451
UniProt: G8M491
Position
1:1818341..1819120
Genome map
AA seq 259 aa AA seqDB search
MSALSPIVQRVLITNDDGIDAPGLAVLEAVAAELAHEVWVIAPEHDQSGTSHSISLHSPL
RVSRQGERRYGVQGTPGDCVVMAARHIMKDAPPTLVLSGINRGANLGVETMFSGTVGAAM
TGLLLGLPSIALSQTFTDRENVRWDTARTLAPGVIRQLLSISHDAPTCLNVNFPDCDASA
AGPLTVTRQGVGLVEGIDVLPMVDPRGIEYHWLRFQRGPRPNSPDSETAVVASGRVSVTP
LHFDRTDERTFATLEAALR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccctctcacccatcgtgcagcgtgtgctcatcaccaacgacgacggcatcgac
gcgcccggcctggccgtgctcgaagccgttgccgccgaactcgcgcatgaagtctgggtg
atcgcccccgagcacgatcaaagcggcacctcgcattccatcagtctgcattcgccgctg
cgcgtctcgcgtcagggcgaacggcgctacggcgtgcaaggcacacccggcgactgtgtc
gtaatggccgcgcgccatatcatgaaagacgcgccgcccacgctcgtgctgtcgggcatc
aaccgcggcgcgaatctcggcgtcgagacgatgttctccggcaccgtcggcgccgcaatg
acgggtttgctgctcggcctgccgtcgatcgcgctgagccagaccttcaccgaccgcgag
aacgtgcgctgggatacggcccgcacgctcgcgcccggcgtgatccgccagttgctttcg
atttcccacgacgcgccgacctgcctcaacgtcaatttccccgattgcgatgcgtccgcc
gccggtccgctcaccgtgacgcgacaaggcgtagggctcgtggaaggcatcgacgtgctg
ccgatggtcgatccgcgcggcatcgagtatcactggctgcgctttcagcgcggcccgcgc
ccgaactcgcccgatagcgaaacggcggtggtcgcgtccgggcgcgtgtccgtcacgccg
ctgcatttcgatcgcaccgacgaacgcactttcgccacgctcgaagcggctctgcgctag

DBGET integrated database retrieval system