KEGG   Burkholderia sp. YI23: BYI23_A023270Help
Entry
BYI23_A023270     CDS       T01711                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00361  Chlorocyclohexane and chlorobenzene degradation
byi00625  Chloroalkane and chloroalkene degradation
byi01100  Metabolic pathways
byi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BYI23_A023270
   00361 Chlorocyclohexane and chlorobenzene degradation
    BYI23_A023270
Enzymes [BR:byi01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BYI23_A023270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AET90165
UniProt: G8M8C0
Position
1:complement(2625119..2625742)
Genome map
AA seq 207 aa AA seqDB search
MTIKAVVFDFGGVLIDWNREYLYKQLIPDETERRWFLDNVCKMEWVVQQDGGQTIEDGTA
ELIALHPGHEALIRAFYARWPEMVSGVLDEGVALVDRLEAARVPIFGLTNWSAETFPYAW
ERFDVLRKFREIVVSGRVGLVKPDPRIFGLMHAEIERHLPGIQPQELVFIDDNLKNAQAA
TALGWHGVHYTGALETETKLRELALPL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaaagcagtcgtgttcgatttcggcggcgtgctcatcgactggaatcgcgag
tatctctacaagcagctgattcccgacgaaaccgagcgccgctggtttctcgacaacgtc
tgcaagatggaatgggtcgtgcagcaggacggcgggcagaccatcgaggacggcaccgcc
gagctgatcgcgcttcatcccgggcacgaagcgctgatccgcgcgttctatgcgcgctgg
ccggaaatggtgtcgggcgtgctggacgagggcgtggcgctcgtcgatcggctggaggcg
gcgcgcgtgccgatttttgggctgacgaactggtcggctgagacgtttccgtacgcgtgg
gaacgcttcgacgtgctgcgcaagtttcgcgaaatcgtcgtgtcggggcgcgtcggtctc
gtcaagcccgatccgcggattttcggcctgatgcacgcggagatcgaacggcatctgccg
ggcatccagccgcaggaactcgttttcatcgacgacaacctgaagaacgcgcaagccgcg
accgcgctcggctggcacggcgttcactacaccggcgcgctggaaacggagacgaagctg
cgggaactggcgctgccgctctga

DBGET integrated database retrieval system