KEGG   Burkholderia sp. YI23: BYI23_A024170Help
Entry
BYI23_A024170     CDS       T01711                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00860  Porphyrin and chlorophyll metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BYI23_A024170
Enzymes [BR:byi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BYI23_A024170
Exosome [BR:byi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BYI23_A024170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AET90255
UniProt: G8M8T9
Position
1:2723567..2724562
Genome map
AA seq 331 aa AA seqDB search
MSFYPHHRPRRMRRDDFSRRLMRENILTANDLIYPVFIVEGTNVRQTVPSMPGVERTSVD
LLMKVAEQCVELGVPVISLFPAIEPSIKTPDGREATNPEGLIPRAVRELKKNFPTLGVLT
DVALDPYTSHGQDGVLDEEGYVKNDETSEILVEQARTQAEAGVDIVAPSDMMDGRIGAIR
EMLESESHIHTRIMAYAAKYASAFYGPFRDAVGSAANLGKGNKMTYQMDPSNSDEAMREV
RMDIEEGADMVMVKPGMPYLDIVRRVKDEFRFPTYAYQVSGEYAMIKAAAQNGWIDHDKV
MMEALLAFKRAGADGVLTYFALDAARILRAS
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagcttctatcctcaccatcgcccgcgccgcatgcgccgcgatgacttctcgcgccgt
ctgatgcgcgaaaacatcctcactgcgaacgacctcatttatccggtgttcatcgtcgaa
gggacgaatgtgcgccagaccgtgccgtcgatgcccggcgtcgagcgcacgtcggtcgat
ttgctgatgaaagtcgccgaacaatgcgtcgagctgggcgtgccggtgatctcgctcttc
cccgcgatcgagccgtcgatcaagacgcccgatggccgcgaggcgaccaatcccgaaggc
ctgattccgcgtgcggtgcgcgagctgaagaagaactttccgacgctcggcgtgctcacc
gacgtcgcgctcgatccgtacacgagccacggccaggacggcgtgctcgacgaagaaggc
tacgtgaagaacgacgaaacgagcgaaatcctcgtcgagcaggcgcgcacgcaggccgag
gcaggcgtggatatcgtcgcgccttcggacatgatggacggccgcatcggcgcgatccgc
gagatgctcgaaagcgaaagccacattcacacgcgcatcatggcgtacgcggcgaagtac
gcatcggcgttctatggcccgttccgcgacgccgtcggctcggccgcgaatctcggcaag
ggcaacaagatgacgtatcagatggacccgtccaactccgatgaagcgatgcgcgaagtg
cgcatggatatcgaggaaggcgcggacatggtgatggtcaagccgggcatgccgtatctc
gacatcgtgcgacgcgtgaaagacgagttccgctttccgacgtatgcgtatcaggtgagc
ggcgagtacgcgatgatcaaggccgcggcgcagaacggctggatcgatcacgacaaggtg
atgatggaagcgctgctcgcgttcaagcgcgcgggcgcggacggcgtgctgacctacttc
gcgctggacgccgcgcggattctgcgcgcttcctga

DBGET integrated database retrieval system