KEGG   Burkholderia sp. YI23: BYI23_A024420Help
Entry
BYI23_A024420     CDS       T01711                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
byi  Burkholderia sp. YI23
Pathway
byi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:byi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BYI23_A024420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:byi03011]
    BYI23_A024420
Ribosome [BR:byi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BYI23_A024420
  Bacteria
    BYI23_A024420
  Archaea
    BYI23_A024420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 PAS_10
Motif
Other DBs
NCBI-ProteinID: AET90280
UniProt: G8M942
Position
1:complement(2738007..2738336)
Genome map
AA seq 109 aa AA seqDB search
MEVKAIHRGARISAQKTRLVADQIRGLPVDKALNVLTFSPKKAAGIVKKVVLSAIANAEH
NEGADIDELKIKSIYVDKAASLKRFTARAKGRGNRIEKQSCHITVTVGN
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagcaattcatcgcggtgcccgcatctcggcgcagaaaacgcgccttgtg
gctgaccagattcgtggtttgccggtcgacaaggcgctgaacgttctgacgttctcgccg
aagaaggcggcgggtatcgtcaagaaggtcgtgctgtctgcgatcgcgaatgcggagcac
aacgaaggcgccgatatcgacgagctcaagatcaagagcatttacgtcgacaaggctgct
tcgctgaagcgtttcaccgcacgcgcaaagggtcgcggtaatcgcatcgagaagcaatcc
tgtcacatcactgtgacggtcgggaattaa

DBGET integrated database retrieval system