KEGG   Burkholderia sp. YI23: BYI23_B001010
Entry
BYI23_B001010     CDS       T01711                                 

Gene name
hcp
Definition
(GenBank) hcp protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
byi  Burkholderia sp. YI23
Pathway
byi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:byi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BYI23_B001010 (hcp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_B001010 (hcp)
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_B001010 (hcp)
SSDB
Motif
Pfam: T6SS_HCP ELP6
Other DBs
NCBI-ProteinID: AET90708
Position
2:complement(128445..128921)
AA seq 158 aa
MCRPVLWDCVSFVEGSNKVQGHEGKILVQAVDHTIEIPKSPQTGLPTGKRVHGAMTITKE
IDKSSPKLFQALTSGEQMKDVSLEFYRVSPKGTEEKYYTVKLSNAILTNMKSWTPNALDP
NNKQIGHMEDLAFTYEKISWTYEPDGIEAEDSWLAPKA
NT seq 477 nt   +upstreamnt  +downstreamnt
atctgccggccggtgctttgggattgtgtttcattcgtagaaggctcgaacaaagtccaa
ggtcacgaaggaaagattctcgtacaggccgtcgatcacaccatcgaaatcccgaagagc
ccgcaaacgggtttgcctaccggcaagcgcgtgcatggggcgatgacgattaccaaggaa
atcgacaagtcctcgcccaagctgtttcaggcgctgacctcgggcgagcagatgaaggac
gtgtcgctggagttctaccgcgtctcgccgaagggcacggaagagaagtactacaccgtg
aaactgtcgaatgcgattctgacgaatatgaagtcgtggacgccgaatgcgctggatccg
aacaacaagcaaattggccacatggaagacctcgcgttcacgtacgagaagatcagctgg
acatacgaaccggacggtatcgaagccgaagattcgtggcttgcgccgaaggcttga

DBGET integrated database retrieval system