KEGG   Burkholderia sp. YI23: BYI23_B011860Help
Entry
BYI23_B011860     CDS       T01711                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
byi  Burkholderia sp. YI23
Pathway
byi00020  Citrate cycle (TCA cycle)
byi00190  Oxidative phosphorylation
byi00650  Butanoate metabolism
byi01100  Metabolic pathways
byi01110  Biosynthesis of secondary metabolites
byi01120  Microbial metabolism in diverse environments
byi01130  Biosynthesis of antibiotics
byi01200  Carbon metabolism
Module
byi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
byi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
byi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:byi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BYI23_B011860
   00650 Butanoate metabolism
    BYI23_B011860
  Energy metabolism
   00190 Oxidative phosphorylation
    BYI23_B011860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AET91793
UniProt: G8MCH6
Position
2:complement(1378495..1378863)
Genome map
AA seq 122 aa AA seqDB search
MATQNRVGPKRLVVGAHYGLRDWLAQRITAVVMAAYTVILLFWFFAAHNFSYEGWAGIFA
TQWMKLATFVALLCLFYHAWVGIRDIWMDYVKPMGVRLFLQVLTILWLIGCAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcaaaatcgagtcggccccaagcgcctggtcgtgggcgcgcattacggtctg
cgcgactggctcgcgcaacgcatcaccgcggtggtgatggccgcgtacaccgtcattctg
ctgttctggttcttcgccgcgcacaacttctcgtatgaaggctgggcgggcatcttcgcg
acccagtggatgaagctcgcgacattcgtagccttgctttgcctgttctatcacgcgtgg
gtcggcattcgcgacatctggatggattacgtgaagccgatgggcgtgcgcctgttcctg
caggtgttgaccatcctgtggctcatcggatgcgccggctacgctgcacagattctctgg
agagtttaa

DBGET integrated database retrieval system