KEGG   Burkholderia sp. YI23: BYI23_B014860Help
Entry
BYI23_B014860     CDS       T01711                                 

Gene name
phnG
Definition
(GenBank) phosphonate C-P lyase system protein PhnG
  KO
K06166  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnG [EC:2.7.8.37]
Organism
byi  Burkholderia sp. YI23
Pathway
byi00440  Phosphonate and phosphinate metabolism
byi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:byi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BYI23_B014860 (phnG)
Enzymes [BR:byi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.37  alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase
     BYI23_B014860 (phnG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhnG Se-cys_synth_N
Motif
Other DBs
NCBI-ProteinID: AET92093
UniProt: G8ME43
Position
2:1711219..1711719
Genome map
AA seq 166 aa AA seqDB search
MGKAMSTSMEPHAPHARGRREWMAVLARTPREALRAALDAALDGERLPAYEWLRAPDIGL
AMVRARIGGTGDAFNLGETTVTRATLRVRTGDGSAPVGVAVHMGRDKERATLAALVDALL
QMPRYADRLQARVIEPLAACIADERHRRQAQAAATKVEFFTMVRGE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atagggaaagcgatgagtacttcaatggagccgcacgcgccccacgcgcggggccgccgc
gaatggatggcggtgctcgcccgcacgccacgcgaggcgctgcgagcggcgctggacgcg
gcgctcgacggcgagcgcctgcctgcatacgaatggctgcgcgcgccggatatcgggctt
gcgatggtgcgcgcgcgcatcggcggcacgggcgatgccttcaatctcggcgagacgacc
gttacgcgcgccacgctgcgtgtgcgcaccggcgacggcagcgcgccggtcggcgtcgcg
gtgcacatgggccgcgacaaggagcgcgcgacgctcgccgcgctcgtcgacgcgctgctg
caaatgccgcgctacgcggaccgcttgcaggcgcgcgtcatcgagccgctcgccgcgtgc
atcgcggacgaacgacatcgcaggcaagcgcaagcggccgcgaccaaggtcgaattcttc
acgatggtgagaggcgaatga

DBGET integrated database retrieval system