KEGG   Burkholderia sp. YI23: BYI23_C001910
Entry
BYI23_C001910     CDS       T01711                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_C001910
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_C001910
SSDB
Motif
Pfam: T6SS_TssF DUF5690
Other DBs
NCBI-ProteinID: AET92337
Position
3:211245..212969
AA seq 574 aa
MFNRYYQDELNKLKGLAGEFARANPAMAPMLSGTSADPDVERLLEGVAFLTGLTRQKLDD
QFPEFVQELTNLLFPHYLRPVPASTLVSFAAKGPRAQAARVAAGAELASVPVDGTSCRFR
TTCDLDVEPLSIAEVNLLSHAGAAPVLMIDFEMEGGASIAQWNGDSIRLFLSGGHVDASK
LLLLLMNHVTDVRISSGGGERLSLGAKNLRASGFDADLLTYPSQALSGYRTIQEFFTQPE
KFLFVDITGLKPWTAKAKGSSFSIVMTLDALHDWMPAIDGNSFMLNVVPAINVFSHVADP
ITHDHRATEYRVNPEGRDRRHYQIYSVDQVLGYQQGRAQERLYQPFSMFRHDGRGAQLSY
RTTLKSANVERGSDVYLSLNYPPSETPLPETLSIRVTCTNRALPEGLKPGDINVPTSTSP
DQMSFTNIRAITPAQDPPAGEELLWCLLSHVSLNLLSLANADNLRKLLGLYVFNGRQGQE
LSNRRRIEGIVDVTATRETRLVGRGGMQRGQSIRIRCREDHYAGIGDLYLFGCMLERFLG
DYAGINAYTRVELEDTLSGTVFKWPPRLGQQPML
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgttcaatcgatactatcaggatgagctgaacaagctgaaaggcttggccggagagttc
gcacgcgcgaatcccgcgatggcgccgatgctctcgggcacgtcggccgatccggatgtc
gaacgcctgctcgaaggcgtcgcgtttctcacgggcctcacgcgccagaagctcgacgac
cagtttcccgagttcgttcaggaactcaccaatctgctgtttccgcattatctgcggccc
gtgccggcctcgacgctcgtgagctttgccgcgaaaggcccgcgtgcgcaggcggcgcgc
gtggccgcgggcgccgagctggcatcggtgccggtggatggcacgtcgtgccgctttcgc
acgacatgcgatctcgatgtcgagccgctctccatcgccgaagtgaacctgctgagtcac
gcgggcgcggcgcccgtgctcatgatcgacttcgaaatggaaggcggcgcgagcatcgcg
caatggaacggcgactcgattcgcctgtttctgagcggcggccatgtcgatgcatcgaag
ctgctgttgctgctgatgaatcacgtcaccgacgtgcgcatttcgagcggcggcggcgag
cgtctctcgctgggcgcgaagaatctgcgcgcgagcggcttcgacgccgatctgctcacg
tatccgagccaggcgctgtccggctatcgcacgatccaggaattcttcacgcagccggaa
aagtttctcttcgtggatatcacgggcctcaagccctggaccgcgaaggcgaagggttcg
agcttcagcatcgtgatgacgctcgatgcgctgcacgactggatgcctgcgatcgacggt
aacagcttcatgctcaacgtcgtgcccgcgatcaacgtgttctcgcatgtcgccgatccg
atcacgcacgatcatcgcgcgacggaatatcgcgtgaaccccgaaggccgcgaccgtcgc
cattaccagatttattccgtcgatcaggtgctcggctatcagcagggccgcgcgcaggaa
cgcctctatcagccgttttcgatgttccgccacgacggacgcggcgcgcaactgagctac
cgcacgacgctcaagagcgcgaacgtcgaacgcggcagcgacgtgtatctgtcgctcaac
tatccgccctccgagacgccgctgccggaaacgctgtcgatccgcgtcacctgcacgaac
cgcgcgttgccggaaggcctgaagccgggcgacatcaacgtgccgacgagcacgtcgccg
gatcagatgagcttcaccaatatccgcgcgatcacgcccgcgcaggacccgcccgcgggc
gaggaactgctgtggtgcctgctctcgcatgtctcgctgaatctgctctcgctcgcgaac
gccgacaatctgcgcaagctgctcggcctctacgtcttcaacgggcggcaagggcaggag
ctgtcgaaccggcggcgcatcgaaggcatcgtcgatgtcacggccacgcgcgaaacgcgg
ctcgtcgggcgcggcggaatgcagcgcggccagtcgatccgcatccgttgccgtgaggac
cattacgccggaatcggcgacctgtatctgttcggctgcatgctcgaacgcttcctcggc
gattacgccggcatcaatgcctatacgcgcgtcgagctcgaagacacgctttccgggact
gtattcaaatggccgccgagactcgggcaacaaccgatgctgtaa

DBGET integrated database retrieval system