KEGG   Burkholderia sp. YI23: BYI23_C001920
Entry
BYI23_C001920     CDS       T01711                                 

Definition
(GenBank) hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_C001920
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_C001920
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: AET92338
Position
3:212933..213916
AA seq 327 aa
MAAETRATTDAVKALLLTNGEKYSYFQAIRLLRLYDRHTGLNQENLRVRPRLGLGFPEND
IDRIEETAEGGYRITANFFGLYGVASPLPTYYTEDLFEEEREGHHVTRDFLDIVHHAMYP
LLFDAWAKYRVEQRIVEDRHEASLNQLYAFVGLHDPDLRVDLLPGSAELLRYAGLFNQRP
HSALGLKTLLADAFAPARVEVVCGVVRAVPIPADQRWQLGQQPGRLGEDVWLGSEIDDHE
GAIRIEFADLPHTLFHQMLPGGSAHARLSFFTRFYLTDPLDVEVELRLRRDETGAARTGR
GAWSRLGFDTWLNPGEAALPTRVKFAL
NT seq 984 nt   +upstreamnt  +downstreamnt
atggccgccgagactcgggcaacaaccgatgctgtaaaggcgctgcttctcaccaatggt
gagaagtactcctacttccaggcgatccgcctgctgcgtctctacgaccggcacacgggc
ctgaatcaggagaacctgcgcgtgcgcccgcggctcgggctcggttttcccgagaacgat
atcgaccgcatcgaggaaacggcggagggcggctatcgcatcacggcgaatttcttcggc
ctgtacggcgtggcgtcgccgctgccgacgtattacacggaagatcttttcgaggaagag
cgcgaaggccatcacgtcacgcgcgattttctcgacatcgtgcatcacgcgatgtatccg
ctgctcttcgatgcgtgggcgaagtaccgcgtcgagcagcgcatcgtcgaggaccggcac
gaggcgtcgctcaatcagttgtatgcgttcgtcgggctgcacgatcccgatctgcgcgtc
gatctgctgccgggcagcgccgaattgctgcgctatgcggggttgttcaatcagcgtccg
cattcggcgctcggcctgaaaacgctgctcgccgatgccttcgcgcccgcgcgagtcgag
gtcgtgtgcggcgtggtgcgcgcggtgccgattcccgccgatcagcgctggcagctcggg
cagcagccaggccgcctcggcgaagacgtgtggctcggctcggagatcgacgaccacgaa
ggcgcgattcgcatcgaattcgccgatcttccgcacacgctttttcatcagatgctgccg
ggcggcagcgcgcacgcgcgtctgtcgtttttcacgcgtttctatctgaccgatccgctc
gacgtggaagtggaactgcgcctgcgccgcgacgaaaccggggccgcgcgtacgggtcgc
ggcgcgtggtcgcggctcggtttcgatacatggcttaaccccggcgaggcggcgttgccg
acccgggtcaaattcgctctctaa

DBGET integrated database retrieval system