KEGG   Burkholderia sp. YI23: BYI23_C002020Help
Entry
BYI23_C002020     CDS       T01711                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
byi  Burkholderia sp. YI23
Pathway
byi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:byi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BYI23_C002020
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_C002020
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_C002020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU TadE
Motif
Other DBs
NCBI-ProteinID: AET92348
Position
3:227190..227879
Genome map
AA seq 229 aa AA seqDB search
MTLADTLIPLFAHVRAFTRSPSGDAASLTAQLDSAIAAARLRAHDAGFAQADIDEALFAF
NAWADELLLTTQWEGAPQWQRHLLQRRYSNVSNAGVVFYERLAQLTPSQLAVREVFYLCL
ALGFGGRYAYDRNQKTLTDIRRTNLAMLLPDADQLGASARAFLFPDGYHTAGDEAAARGQ
SARARFSARFTRGKLTAIVLPLLLLALLYGVYHTVVAQSVESLLAQIHL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgccgatacgctcattcccctgttcgcgcacgtgcgcgccttcacgcgctcg
ccttcgggcgatgccgcgagcctcaccgcgcagctcgacagcgccatcgcggcggcgcgg
ctgcgcgcgcacgacgccggtttcgcgcaggccgatatcgacgaggcgctgttcgccttc
aacgcctgggccgacgaactgctgctcacgacgcaatgggaaggtgcgccgcaatggcag
cgtcatctgttgcagcggcgctattcgaacgtgagcaacgcgggcgtcgtgttctacgag
cgcctcgcgcaactgacgccttcgcaactggcggtgcgcgaagtgttctatctgtgtctc
gcgctcggcttcggcgggcgctatgcgtacgaccgcaaccagaagacgctcaccgacatc
cgccgcaccaatctcgcgatgctactgcccgacgctgaccagctcggcgcgtcggcgcgc
gcgttcctgtttccggacggctatcacaccgcgggcgatgaagccgcggcgcgcggccaa
agcgcgcgcgcccgtttttcggcgcgcttcacgcgcggcaagctgaccgcgatcgtcttg
ccgctgctcctgctggcgctgctgtacggcgtgtatcacaccgtcgtcgcgcagtccgtc
gagtcgcttctcgcgcagatccatctatga

DBGET integrated database retrieval system