KEGG   Burkholderia sp. YI23: BYI23_C003630Help
Entry
BYI23_C003630     CDS       T01711                                 

Definition
(GenBank) type VI secretion system lysozyme like protein
  KO
K11897  type VI secretion system protein ImpF
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_C003630
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_C003630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: AET92509
Position
3:417357..417866
Genome map
AA seq 169 aa AA seqDB search
MRMRNADRVRPSLLDRLTDHAPGASREGREHRASSARAQRLSVMRDIGWLLNAQGIASAQ
DIARFPEVAGSVLNFGFADLAGKSASNVDIGRIERLMSDAIGAFEPRIVPGTLRVRAVQS
GDAAIQHNALAFIVEADLHAHPVPERLYLRTELDLEAGKAKVFEGAIER
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atccgcatgagaaacgcggacagagtgcggccgtcgctgctcgaccgtctgaccgatcat
gcgcccggcgcatcgcgcgaagggcgcgagcaccgggccagttcggcgcgcgcgcaacgc
ctgagcgtgatgcgcgatatcggctggctgctcaacgcgcagggtatcgcgtcggcgcag
gatatcgcgcgctttccggaagtcgcgggatcggtgctcaacttcggtttcgcggacctg
gccggcaagagcgcgtcgaacgtcgatatcggacggatcgaacgattgatgagcgacgcc
atcggcgcgttcgagccgcgcatcgtgcccggcacgctgcgggtgcgcgccgtgcagtcc
ggcgacgcggccattcagcacaacgcgctggccttcatcgtggaggcggatctgcatgcg
catcccgtgccggagcgcctctatctgcgcacggagctggatctggaagcaggcaaggcc
aaggtattcgaaggagccatcgagcgatga

DBGET integrated database retrieval system