KEGG   Burkholderia sp. YI23: BYI23_C010230
Entry
BYI23_C010230     CDS       T01711                                 

Gene name
evpB
Definition
(GenBank) type VI secretion protein, EvpB
  KO
K11900  type VI secretion system protein ImpC
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_C010230 (evpB)
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_C010230 (evpB)
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AET93169
Position
3:complement(1200236..1201789)
AA seq 517 aa
MNKKEARASAAGETVVLDAPQASQGDSVYAALCDKINLSPVSQARPLEAFRDNDMLSEAS
ADERLARGMGAFLDLVAQTSKPVDRLDKSLLDFFIGQLDRQISRQLDSVMHNPEFQALEG
RWRGLKMLVSRTDFRKNARIEVLDVSKDALVRDFEDAPELIQSGLYRLTYIEEYDTPGGQ
PISAMISDFEFANSPQDVALLRNISKVAAAAHMPFIGSVGAAFFGKKSMEEVAAIQDIGN
YFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGKDTTPVRAFNYEEQVKGPDHDRYL
WVNASFAFAANMTRSFVNNGWCVQIRGPQAGGKVEDLPVHLYDLGTGVQPKIPTEVLIPE
TREFEFANLGFIPLSFYKNHDFACFFSANSSQKPALYETKEATANSRINARLPYIFLLSR
IAHYLKLIQRENIGTTKDRRLLELELNNWIKGLVTEMKDPGDELQASHPLREAKVMVEDI
EDNPGFFRIKLFIVPHFQVEGMDIGLSLVSQMPKAKS
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgaacaagaaagaagcccgcgcgagcgccgctggcgagaccgtcgtgctcgacgccccg
caagcgtcacagggtgacagcgtctacgcagccctttgcgacaagatcaacctgagcccg
gtgtcgcaggcgcgcccgctcgaagcattccgtgacaacgacatgctctccgaagcctcc
gccgacgagcgcctggcacgcggcatgggcgcgttcctcgatctcgtcgcgcagacgagc
aagccggtggatcgtctcgacaagtcattgctggatttcttcatcggtcaactggaccgg
cagatcagccgccagctcgattcggtcatgcacaatcccgaatttcaggcgctggaaggc
cgctggcgtggcctgaagatgctcgtatcgcgcacggatttccgcaagaacgcgcgtatc
gaggtgctcgacgtctcgaaggacgcgctcgtgcgcgacttcgaggacgcgccggaactg
attcagagcgggctgtatcgcctcacttatatcgaggaatacgacacgccgggcggccag
ccgatcagcgcgatgatcagcgacttcgaattcgcgaactcgccgcaggacgtggccttg
ctgcgcaacatctcgaaggttgcggcggcggcgcatatgccgttcatcggttcggtgggc
gcggccttcttcggcaagaagtcgatggaggaagtcgcggccattcaggatatcggcaac
tatttcgatcgcgccgaatacatcaagtggaagagcttccgcgacacggacgactcgcgt
tacgtcggtctcgtgatgccgcgcgtgctgggccgcctgccctacggcaaggacacgacg
cccgtgcgcgcgttcaactacgaggagcaggtgaagggcccggaccacgatcgctatctg
tgggtgaatgcgtcgtttgcgttcgcggcgaacatgacgcgcagcttcgtgaacaacggc
tggtgcgtgcagattcgcggcccgcaggcgggcggcaaggtggaagacctgccggtgcat
ctgtacgacctcggcaccggcgtgcagccgaagattccgaccgaagtgctgattcccgag
acgcgcgagttcgagttcgccaacctcggcttcattccgctctcgttctacaagaaccac
gatttcgcgtgcttcttctcggcgaactcgtcgcaaaagcccgcgctctacgagaccaag
gaagcgacggcgaatagccgcatcaacgcgcgtctgccgtacatcttcctgctgtcgcgc
attgcgcattacctgaagctgattcagcgcgagaacatcggcacgaccaaggaccgtcgt
ctgctggagctcgaactgaacaactggatcaagggcctcgtcaccgagatgaaggacccg
ggcgacgaactgcaggcgtcgcatccgctgcgcgaggcgaaggtgatggtcgaagacatc
gaggacaaccccggcttcttccgcatcaagctgttcatcgtgccgcacttccaggtggaa
gggatggatatcggcctgtcgctggtgtcgcagatgccgaaggcgaagagctga

DBGET integrated database retrieval system