KEGG   Burkholderia sp. YI23: BYI23_C010280
Entry
BYI23_C010280     CDS       T01711                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
byi  Burkholderia sp. YI23
Pathway
byi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:byi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BYI23_C010280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_C010280
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_C010280
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AET93174
Position
3:1206688..1207173
AA seq 161 aa
MAIPAYLWLKDDGGADIKGSVTVQGREGSVEIVEFDHGVHIPTDGNTGKLTGTRVHAPIT
LTKETDSSTPYLYKAVTSGQTLKSVEIKWYKIDDAGKEKEYFNTKLDNVKVVAVRPKMLD
IKNPAYEKHNHLEEVELRYEQITWSYKDGNIIHKDTWNERA
NT seq 486 nt   +upstreamnt  +downstreamnt
atggcaattcccgcatatttgtggctgaaggatgacggcggcgccgacatcaagggttcc
gtcacggtgcaaggtcgcgaaggcagcgtcgaaatcgtcgagttcgatcacggcgtgcac
attccgaccgatggcaacaccggcaagctgaccggcacgcgcgtccacgcaccgatcacg
ctgacgaaggaaaccgactcatcgacgccgtacctgtacaaggcggtgacgagcggccag
acgttgaagtcggtcgagatcaagtggtacaagatcgacgacgcgggcaaggagaaggag
tacttcaacacgaagctcgacaacgtcaaggtcgtcgcagtgcgtccgaagatgctcgac
atcaagaatccggcctacgagaagcacaaccacctggaagaagtcgaactgcgctacgaa
cagatcacctggtcgtacaaggacggcaacatcatccacaaggacacgtggaacgagcgc
gcgtaa

DBGET integrated database retrieval system