KEGG   Burkholderia sp. YI23: BYI23_D001520
Entry
BYI23_D001520     CDS       T01711                                 

Gene name
impA
Definition
(GenBank) ImpA
  KO
K11902  type VI secretion system protein ImpA
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_D001520 (impA)
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_D001520 (impA)
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: AET93662
Position
byi_1p:185833..186843
AA seq 336 aa
MIDVEPLLAPTETMPPAGIDLEYDPAFLALDALARGNPERQFEALAEPTAWPDVLEASQA
LLAKSKDLRIGVVYARAASRVHGLAGFHAGLRLLTGLFERYWDTLYPPLDADDDNDPALR
VNALAPLADAYTPFAESETLLHDLRESEVCRARGERLTVRDMLVAQGRLAAAQGESAATP
ARVEGMLADALARDRDTLAEGLDLPRAVQALSDALTGRLGAERAPLLADMLGTARLVAAQ
MHAAAPQAEPQTVTAPQAGVERRATARPGEIATREDAVALLDSVCAFLERTEPAHPAPLL
IRRARGLMGKDFLSVMRDLAPGSLDQIHLIAGTKPE
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgatcgacgtcgaacctctactagcgccgaccgagacgatgccgcccgcgggcatcgat
ctcgaatacgacccggcgtttctcgcgctcgatgcgctcgcgcgcggcaatcccgagcgc
cagttcgaagcgctcgccgagccgaccgcatggccggacgtgctggaagcgtcgcaggcg
ctgctcgcgaagtcgaaggatctgcgcatcggcgtggtctatgcgcgcgcggcctcgcgt
gtgcacggcctcgcgggtttccatgcgggcttgcgcctcctgaccgggctgttcgagcgc
tactgggacaccctctatccgccgctcgatgccgacgacgacaacgatcccgcgctgcgc
gtcaacgcgctcgcgcccctcgccgatgcgtacacgccgttcgctgaaagcgaaacgctg
ctgcacgatttgcgggagtccgaagtgtgccgcgcgcgcggcgaacggctgaccgtgcgc
gatatgctcgtcgcgcagggaaggctggcggcggcacaaggcgagagcgcggcgacgccc
gcgcgcgtcgaaggcatgctcgccgatgcgctcgcgcgggatcgcgacacgctcgccgaa
ggcctcgatctgccgcgcgccgtgcaggcgctctccgatgcgctgaccggccggctcggc
gcggaacgcgcgccgctgctcgcggacatgctgggcacggcgcgtctcgtggccgcgcaa
atgcacgcggcggcgcctcaggcggagccccaaaccgtaaccgcgccgcaagcgggcgtc
gaaagacgcgcgaccgcgcggcctggcgagatcgccacgcgtgaagacgccgttgcgctg
ctcgattcggtttgcgcgttcctggagcgcaccgagcccgcgcatcccgcaccgcttttg
attcgccgggcgcgcgggctgatgggcaaggattttctctctgtgatgcgcgatctcgcg
cccggcagcctcgaccagattcatttgatcgcggggaccaagccggagtga

DBGET integrated database retrieval system