KEGG   Burkholderia sp. YI23: BYI23_D001530Help
Entry
BYI23_D001530     CDS       T01711                                 

Gene name
sciH
Definition
(GenBank) putative cytoplasmic protein,SciH
  KO
K11901  type VI secretion system protein ImpB
Organism
byi  Burkholderia sp. YI23
Brite
KEGG Orthology (KO) [BR:byi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:byi02044]
    BYI23_D001530 (sciH)
Secretion system [BR:byi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BYI23_D001530 (sciH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA ParB_C
Motif
Other DBs
NCBI-ProteinID: AET93663
Position
byi_1p:186923..187459
Genome map
AA seq 178 aa AA seqDB search
MATSSQKFIGRNRAPRVQIEYDVETYGSEKKVQLPFVMGVMADLSGKPAEPLPPVDQRKF
QEIDIDNFDSRMKAMHPRVAFQVPNRLTGEGNLSVDITFDNMSDFSPAAVARKVDALGKL
LEARTQLANLVIFMDGKTGAEELIARVLDDPALLKTLASAAPAANDATAADAAAKPAE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccagcagtcagaaattcatcggccgcaatcgcgcgccgcgcgttcagatcgaa
tacgacgtcgaaacctacggcagcgagaagaaggtccagcttccgttcgtgatgggcgtc
atggccgatctttccggcaaacccgccgagccgctgccgcccgtcgaccagcgcaaattc
caggagatcgacatcgacaacttcgacagccgcatgaaggcgatgcatccgcgcgtcgcg
ttccaggtgccgaacaggctgaccggcgagggcaatctgagcgtcgatatcaccttcgac
aacatgagcgacttctcgcccgccgccgtcgcgcgcaaggtcgatgcgctcggcaagctg
ctcgaagcgcgcacccagctcgccaatctcgtcatcttcatggacgggaagacgggcgcg
gaagaactgatcgcgcgcgtgctcgacgatcccgcgctgctcaagacgctcgcgtccgcc
gcgccggccgcgaacgatgccaccgccgccgatgccgccgcaaagcccgccgaatga

DBGET integrated database retrieval system